Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6w1wA_

Fold library idPDB HeaderMoleculeTitle
c6w1wA_2.58PDB header: toxinChain: A: PDB Molecule: motility-associated killing factor makb;


Added to library: Sat Mar 28 08:26:29 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence XLSPNVDTALNXLTDVYTDFLGISNYDATCNSLFIGHVAKDPNWLVEVRSRTEILRAVMNEFMQQKPKIF
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP)

S



B


SS

TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence AQIITSFINYQTTFDACAQNTSTKQWIECLQLLQKTLKQNITLTNEAQQVFTKSYNQAKNAEELLASSIQ
Predicted secondary structure













SS confidence





































































Known secondary structure (DSSP) S



 .........150.........160.........170.........180.........190.........200.........210
Sequence DGWNELASEEQAMVRIATEIGSLSQSIASLGANVTAAQLRAGKAYIQSMVTISYGVVMTTSVPFLSFAGA
Predicted secondary structure







SS confidence





































































Known secondary structure (DSSP) TTGGGTS



TT



SSS
 .........220.........230.........240.........250.........260.........270.........280
Sequence LFTVGYSAYSTISSAKEVQQDLDKLTQLQTLASEEAQAAAITKAIIQTLSNMSEEFLKIDDSLPALSLLW
Predicted secondary structure


SS confidence





































































Known secondary structure (DSSP) SSS
T
TTSS
TTGGG
 .........290.........300.........310.........320.........330.........340........
Sequence QDELDKVNELINALQSGSDPALLTDLQTIKIASASWKTISEFVQLISLPPNVGKPVLVNTLNNTIQEQ
Predicted secondary structure


















SS confidence



































































Known secondary structure (DSSP) TT

GGG
TTS




TTTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D