Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6vzzA_

Fold library idPDB HeaderMoleculeTitle
c6vzzA_2.65PDB header: transferaseChain: A: PDB Molecule: bamaa.19900.a;


Added to library: Sat Mar 28 08:32:22 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence ELSQEVTQTLKQWRVAAVSSAGLKYYVGVDIGGTNTRLALARAEDHDTFLQVLKVKADDTRKLIAFFDSV
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)


GGGGGSTT



SSTT
SS


SS
 .........80.........90.........100.........110.........120.........130.........140
Sequence SDSIRDLLGVEASGACLAGAGRISPDGEVLDVTNFHGDATHRRLKRSELPSFLFPPTKTHFINDLEGTCY
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)
S

SS
TTS
TT

SSGGGS
TTTS
TTS
 .........150.........160.........170.........180.........190.........200.........210
Sequence GVSSMNASDALDQCFKPLWGPASSDKVTLQPDHYLVLAVGTGLGIATLLSLRGGFQVMPMEFGHVAISPV
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP) TT
GGGTSTTTTS




SS
SSS







GGGSB



 .........220.........230.........240.........250.........260.........270.........280
Sequence GPANAAYAEETRLLEYISEKLYNKEHAIEYEDIVSGRGLVITYKWVLDEANVQDESLRSLDAGKIAKNAT
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)
TTSTTTTSS

BGGGTSSTT


TTGGG

TT
 .........290.........300.........310.........320.........330.........340.........350
Sequence NSEACPYAHKAMMLHFKFLMRIAKNLCIGLQVRGMLLAGDNQVNNNLFLEQNLESLRAEFFDHPKKAWIE
Predicted secondary structure
















SS confidence





































































Known secondary structure (DSSP)
TTT
T
SSTTTT
STTT
 .........360.........370....
Sequence DIDLFTQTKPVNLNLHGALYVARG
Predicted secondary structure







SS confidence























Known secondary structure (DSSP) T

S


T


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D