Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6vycA_

Fold library idPDB HeaderMoleculeTitle
c6vycA_2.10PDB header: protein transportChain: A: PDB Molecule: wd repeat-containing protein 91;


Added to library: Sat Mar 28 09:01:43 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence QPFIVLGQEEYGEHHSSIMHCRVDCSGRRVASLDVDGVIKVWSFNPIMQTKASSISKSPLLSLEWATKRD
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)





S

TTSSTT

SSS

SS

SSST
 .........80.........90.........100.........110.........120.........130.........140
Sequence RLLLLGSGVGTVRLYDTEAKKNLCEININDNMPRILSLACSPNGASFVCSAAAPSLTQVPGRLLLWDTKT
Predicted secondary structure



























































SS confidence





































































Known secondary structure (DSSP) TSSSTTTT

SSS

TTSS







TTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence MKQQLQFSLDPEPIAINCTAFNHNGNLLVTGAADGVIRLFDMQQHECAMSWRAHYGEVYSVEFSYDENTV
Predicted secondary structure

























































SS confidence





































































Known secondary structure (DSSP) T


SSS



SSSSTTSTT
SS
S

SS

TTSS
 .........220.........230.........240.........250.........260.........270.........280
Sequence YSIGEDGKFIQWNIHKSGLKVSEYSLPSDATGPFVLSGYSGYKQVQVPRGRLFAFDSEGNYMLTCSATGG
Predicted secondary structure










































SS confidence





































































Known secondary structure (DSSP) TT
TTTTT


GGGT


TTS



S
S
TTSS

TTS
 .........290.........300.........310.........320.........330...
Sequence VIYKLEKVLESCLSLGGHRAPVVTVDWSTAMDCGTCLTASMDGKIKLTTLLAH
Predicted secondary structure























SS confidence




















































Known secondary structure (DSSP)


S





SS
SSS
TTS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D