Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6vjbA_

Fold library idPDB HeaderMoleculeTitle
c6vjbA_2.24PDB header: immune systemChain: A: PDB Molecule: putative cell envelope proteinase;


Added to library: Sat Apr 18 09:06:14 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SLPPVNTDVHDWVKTKGAWDKGYKGQGKVVAVIATGIDPAHQSMRISDVSTAKVKSKEDMLARQKAAGIN
Predicted secondary structure

















































SS confidence





































































Known secondary structure (DSSP)



B

TTTTTTT
S
TT
S


TTSTTS

S
SSSSSS
ST

 .........80.........90.........100.........110.........120.........130.........140
Sequence YGSWINDKVVFAHNYVENSDNIKENQDTKYESHGMHVTGIVAGNSKEAAATGERFLGIAPEAQVMFMRVF
Predicted secondary structure













































SS confidence





































































Known secondary structure (DSSP) S
B

SSSTTTTBS






GGG


B
SS

TTS
B
B
SSTT


 .........150.........160.........170.........180.........190.........200.........210
Sequence ANDIMGSAESLFIKAIEDAVALGADVINLSLGTANGAQLSGSKPLMEAIEKAKKAGVSVVVAAGNERVYG
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)

SSSSS
T
S


BSS

SS
S
TT


S

STT
 .........220.........230.........240.........250.........260.........270.........280
Sequence SDHDDPLATNPDYGLVGSPSTGRTPTSVAAINSKWVIQRLMTVKELENRADLNHGKAIYSESVDFKDIKD
Predicted secondary structure













































SS confidence





































































Known secondary structure (DSSP) TTT


BTT







BTTTSSSS
S
GGGTT
GGGGGG


SS

GGGT
 .........290.........300.........310.........320.........330.........340.........350
Sequence SLGQFAYVKESTDAGIALIERDPNKTYDEMIALAKKHGLGVLIFNNKPGQSNRSMRFISHEFGKAMSQLN
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)



S
S




SSS




SSTT










 .........360.........370.........380.........390.........400.........410.........420
Sequence GNGTGSLEFDSVVSKAPSQKGNEMNHFSNWGLTSDGYLKPDITAPGGDIYSTYNDNHYGSQTGTAMASPQ
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP) SSS
TTTTSB
TT





TTS




S
STT

S
 .........430.........440.........450.........460.........470.........480.........490
Sequence IAGASLLVKQYLEKTQPNLPKEKIADIVKNLLMSNAQIHVNPETKTTTSPRQQGAGLLNIDGAVTSGLYV
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)
TTS
S
B

B
TTT
SB

TT
B

S
 .........500.........510.........520.........530.........540.........550.........560
Sequence TGKDNYGSISLGNITDTMTFDVTVHNLSNKDKTLRYDTELLTDHVDPQKGRFTLTSHSLKTYQGGEVTVP
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP)
TTSSSSSS
SSS
TTTT
 .........570.........580.........590.........600.........610.........620.........630
Sequence ANGKVTVRVTMDVSQFTKELTKQMPNGYYLEGFVRFRDSQDDQLNRVNIPFVGFKGQFENLAVAEESIYR
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP) TTS
STT
SS
TTSS
S
GGGS
SB

B
 .........640.........650.........660.........670.........680.........690.........700
Sequence LKSQGKTGFYFDESGPKDDIYVGKHFTGLVTLGSETNVSTKTISDNGLHTLGTFKNADGKFILEKNAQGN
Predicted secondary structure
































































SS confidence





































































Known secondary structure (DSSP) TT


SS



SSTTB

TTS

B




SSS


S


TT
TTS



TTS
 .........710.........720.........730.........740.........750.........760.........770
Sequence PVLAISPNGDNNQDFAAFKGVFLRKYQGLKASVYHASDKEHKNPLWVSPESFKGDKNFNSDIRFAKSTTL
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)




SSSSSS


BSS
TT
TT

S
S
SS





SSTTS
S
 .........780.........790.........800.........810.........820.........830.........840
Sequence LGTAFSGKSLTGAELPDGHYHYVVSYYPDVVGAKRQEMTFDMILDRQKPVLSQATFDPETNRFKPEPLKD
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP)
SB
TTS
B

SSSTT










TTTT




 .........850.........860.........870.........880.........890.........900.........910
Sequence RGLAGVRKDSVFYLERKDNKPYTVTINDSYKYVSVEDNKTFVERQADGSFILPLDKAKLGDFYYMVEDFA
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) SSSS


BTTBSTTTT

B
TTS


TTTS
GGG
TT
 .........920.........930.........940.........950.........960.........970.........980
Sequence GNVAIAKLGDHLPTPIKLKLTDGNYQTKETLKDNLEMTQSDTGLVTNQAQLAVVHRNQPQSQLTKMNQDF
Predicted secondary structure















































SS confidence





































































Known secondary structure (DSSP) S
TTTT









S




B





TTS
S


SS

S



SS

 .........990.........1000.........1010.........1020.........1030.........1040.........1050
Sequence FISPNEDGNKDFVAFKNNVYNDLTVNVYAKDDHQKQTPIWSSQAGASVSAIESTAWYGITARGSKVMPGD
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP)

SSSSSS

B





S

TT
TT



S

SS

SS
GGGT
B
SB
TTS
B

S
 .........1060.........1070.........1080.........1090.........1100.........1110.........1120
Sequence YQYVVTEHQKQYTISVNDKKPMITQGRFDTINGVDHFTPDKTLDSSGIVREEVFYLAKKNGRKFDVTEGI
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP)













TT




TT



BTTBS


 .........1130.........1140.........1150.........1160.........1170.........1180.........1190
Sequence TVSDNKVYIPKNPDGSYTISKRDGVTLSDYYYLVEDRAGNVSFATLRDLKAVGKDKAVVNFGLDLFTYLV
Predicted secondary structure















































SS confidence





































































Known secondary structure (DSSP)




TTS


BTTB
GGGTTS
TS
SS


 .........1200.........1210.........1220.........1230.........1240.........1250.........1260
Sequence RDADGKPIENLEYYNNSGNSLILPYGKYTVELLTYDTNAAKLESDKIVSFTLSADNNFQQVTFKITMLAT
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP)
TTS
B

S

TT
S

TTT
S
S
STT


 .........1270.........1280.........1290.........1300.........1310.........1320.........1330
Sequence SQITAHFDHLLPEGSRVSLKTAQDQLIPLEQSLYVPKAYGKTVQEGTYEVVVSLPKGYRIEGNTKVNTLP
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP) SS


TT

TTS

B
SS
TTSS

TTS



T
 .........1340......
Sequence NEVHELSLRLVKVGDA
Predicted secondary structure




SS confidence















Known secondary structure (DSSP) T





Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D