Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6veaA_

Fold library idPDB HeaderMoleculeTitle
c6veaA_1.58PDB header: membrane proteinChain: A: PDB Molecule: glutamate receptor 3.2;


Added to library: Sat Sep 26 08:51:49 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence GRRLRIGVPDRASFKEFVSRLDGSNKVQGYAIDVFEAAVKLISYPVPHEFVLFGDGLKNPNFNEFVNNVT
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)




SS
TTSSSTTSS
STSSS


S
SSS


 .........80.........90.........100.........110.........120.........130.........140
Sequence IGVFDAVVGDIAIVTKRTRIVDFTQPYIESGLVVVAPVGTPIRGVDTLISSSGRVGFQVGSYAENYMIDE
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) TTS
S

TTS
S
SB


TT
S

STS
S
TT
TT
 .........150.........160.........170.........180.........190.........200.........210
Sequence LNIARSRLVPLGSPKEYAAALQNGTVAAIVDERPYVDLFLSEFCGFAIRGQEFTRSGWGFAFPRDSPLAI
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) S


GGG
STTS
S

SSS
S




TT
 .........220.........230.........240.
Sequence DMSTAILGLSETGQLQKIHDKWLSRSNCSNG
Predicted secondary structure










SS confidence






























Known secondary structure (DSSP) T


S




Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D