Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6v04A_

Fold library idPDB HeaderMoleculeTitle
c6v04A_1.50PDB header: unknown functionChain: A: PDB Molecule: uncharacterized srpbcc domain-containing protein;


Added to library: Sat Nov 21 08:35:36 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence PDDWVRVMVSVPAPVDEVWEAVTDPRRVAQWFGHLSAPMTTGASTRVDFGDGDFFDIEVDHVEPRDRLLF
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) -


SS
STTTT
SS


TT

SSS
TTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence RWSFLGVGPECQVGWTLTGGAEATTLTVDDSCPGRPGSEVAQLKAGWLDFVGRLARYLETGKPSRYDWRQ
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) TTTS


SS

TT

SS



SS
S
 .........150.........160.........170.........180.........190.........200.........210
Sequence EIDGSVVLPNGSWHPLREETVVDWLPIATNGAGPGWFFVVDEEGPRRFTLRDWQLDRERALTFAVEIPGA
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP) S
SSS

SSSTTTSSSSSS

SSSS

TTT

TT
 .........220.........230.........240.........250.........260.........
Sequence RTVTACQVRTEPGERGRTLSVSHQGWHRLGLSDLQERTLRHRFAATWTAALSLAEECAR
Predicted secondary structure
















SS confidence


























































Known secondary structure (DSSP) SS


TT

GGGS
S


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D