Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6urtC_

Fold library idPDB HeaderMoleculeTitle
c6urtC_3.27PDB header: membrane proteinChain: C: PDB Molecule: low conductance mechanosensitive channel ynai;


Added to library: Sat Oct 31 08:57:01 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence ELFTNNALNLVIIFGSCAALILMSFWFRRGNRKRKGFLFHAVQFLIYTIIISAVGSIINYVIENYKLKFI
Predicted secondary structure








SS confidence





































































Known secondary structure (DSSP)
TTTSSSS


SS

SS
 .........80.........90.........100.........110.........120.........130.........140
Sequence TPGVIDFICTSLIAVILTIKLFLLINQFEKQQIKKGRDITSARIMSRIIKITIIVVLVLLYGEHFGMSLS
Predicted secondary structure









SS confidence





































































Known secondary structure (DSSP)

SS

STTTSS

 .........150.........160.........170.........180.........190.........200.........210
Sequence GLLTFGGIGGLAVGMAGKDILSNFFSGIMLYFDRPFSIGDWIRSPDRNIEGTVAEIGWRITKITTFDNRP
Predicted secondary structure













SS confidence





































































Known secondary structure (DSSP) SS
SS
SSSB
SSS



SS
TTS
 .........220.........230.........240.........250.........260.........270.........280
Sequence LYVPNSLFSSISVENPGRMTNRRITTTIGLRYEDAAKVGVIVEAVREMLKNHPAIDQRQTLLVYFNQFAD
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) GGGGGTS

B
GGG
S



B
SS

TTS
SSB
SSS





S
 .........290.........300.........310.........320.........330.
Sequence SSLNIMVYCFTKTTVWAEWLAAQQDVYLKIIDIVQSHGADFAFPSQTLYMD
Predicted secondary structure












SS confidence


















































Known secondary structure (DSSP) SSB
BS

SSSTTTT













Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D