Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6urfB_

Fold library idPDB HeaderMoleculeTitle
c6urfB_3.60PDB header: oxidoreductaseChain: B: PDB Molecule: nad-dependent malic enzyme;


Added to library: Sat Oct 31 08:36:16 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence YFQSMSDARVPRIPAALSAPSLNRGVGFTHAQRRRLGLTGRLPSAVLTLDQQAERVWHQLQSLATELGRN
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP)





S







S
SSSTT

GGG

T
TTTS
S



T

SSS
 .........80.........90.........100.........110.........120.........130.........140
Sequence LLLEQLHYRHEVLYFKVLADHLPELMPVVYTPTVGEAIQRFSDEYRGQRGLFLSIDEPDEIEEAFNTLGP
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP) S
TTTTS
TTTTT



SS




SSS
S

GGGTTT


 .........150.........160.........170.........180.........190.........200.........210
Sequence EDVDLIVCTDAEAILGIGDWGVGGIQIAVGKLALYTAGGGVDPRRCLAVSLDVGTDNEQLLADPFYLGNR
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP) TT




B
SSSB


GGG


GGG







TT

S
T
 .........220.........230.........240.........250.........260.........270.........280
Sequence HARRRGREYDEFVSRYIETAQRLFPRAILHFEDFGPANARKILDTYGTDYCVFNDDMQGTGAVVLAAVYS
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) T



STTT
SSS



TTTTTTS

 .........290.........300.........310.........320.........330.........340.........350
Sequence GLKVTGIPLRDQTIVVFGAGTAGMGIADQIRDAMVADGATLEQAVSQIWPIDRPGLLFIKIASPTILLGC
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)


TTS

T

TTTS

SSS





SS

S


 .........360.........370.........380.........390.........400.........410.........420
Sequence STVYGAEVVEAMTASCKHPMIFPLSNPTSRMEAIPADVLAWSNALLATGSPVAPVETYVIGQANNVLAFP
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP) SSS





TSSS


B



STTS

SS


S






SS













GGGT
 .........430.........440.........450.........460.........470.........480.........490
Sequence GIGLGVIVAGARLRRMLHAAAKAIAHQANPTNPGDSLLPDVQNLRAISTTVAEAVYRAAVQDGVASRTHD
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) T



TTT
TTSSSS

SS

TT
STTS






 ......
Sequence DVRQAI
Predicted secondary structure
SS confidence





Known secondary structure (DSSP) S

TT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D