Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6umlC_

Fold library idPDB HeaderMoleculeTitle
c6umlC_3.58PDB header: ligaseChain: C: PDB Molecule: protein cereblon;


Added to library: Sat Apr 18 08:32:32 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence NFDTSLPTSHTYLFHGRTLHDDDSCQVIPVLPQVMMILIPGQTLPLQLFHPQEVSMVRNLIQKDRTFAVL
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)


TTTGGGTTT








TT

B
TT





TT

STTTT

 .........80.........90.........100.........110.........120.........130.........140
Sequence YSEAQFGTTAEIYAYREEQDFGIEIVKVKAIGRQRFKQAKVQILPECVLPSTMSAVQLESLNKCQIFSYK
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)



S
TT

B


B



SSTTT

TTS



 .........150.........160.........170.........180.........190.........200.........210
Sequence WWQKYQKRKFHCANLTSWPRWLYSLYDAETLMDRIKKQLREWDLPSNPIDFSYRVAACLPIDDVLRIQLL
Predicted secondary structure











SS confidence





































































Known secondary structure (DSSP) TGGGGGTTS
TT
T


SSS


 .........220.........230.........240.........250.........260.........270.........280
Sequence KIGSAIQRLRCELDIMNKCTSLCCKQCQETEITTKNEIFSLSLCGPMAAYVNPHGYVHETLTVYKACNLN
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)

B

TTTSS
GGGB


SSS
S
TTS
S


S
 .........290.........300.........310.........320.........330........
Sequence LIGRPSTEHSWFPGYAWTVAQCKICASHIGWKFTATKKDMSPQKFWGLTRSALLPTIP
Predicted secondary structure






































SS confidence

























































Known secondary structure (DSSP)
TT
SSTTTTT

SSTT
SS
GGG


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D