Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6ui4A_

Fold library idPDB HeaderMoleculeTitle
c6ui4A_2.65PDB header: hydrolaseChain: A: PDB Molecule: myosin i;


Added to library: Sat Mar 28 08:41:34 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence EIGVSDLTLLSKVSNEAINENLKKRFEGREIYTYIGHVLVSVNPFRDLGIYTDDVLQSYMGKNRLEMPPH
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)

S
SBGGG
SS
STT

TT

SS





TT

TTTS


 .........80.........90.........100.........110.........120.........130.........140
Sequence VFAIAEASYYNMKAYSDNQCVIISGESGAGKTEAAKRIMQYIASVSGGESGDIKQIKDMVLATNPLLESF
Predicted secondary structure
















SS confidence





































































Known secondary structure (DSSP)



BTTSST


S
 .........150.........160.........170.........180.........190.........200.........210
Sequence GNAKTLRNNNSSRFGKYLQIYFNTQGEPVGADITNYLLEKSRVVGQITNERNFHIFYQFAKGASQQYRET
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP) TT
S

TTS




GGGGG


TT


B

 .........220.........230.........240.........250.........260.........270.........280
Sequence FGVQKPETYVYTSRSKCLDVDGIDDLAEFEDTLNAMKVIGLSQPEQDQIFRMLSAILWIGNIQFQEDQGG
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) S



GGG
TTS


BTTB
T

T


TTS
 .........290.........300.........310.........320.........330.........340.........350
Sequence YAEVTDRSVVDFAAYLMEVTPDQLIKGITIRILTPRNGEVIESPANPAQAQATRDALAMAIYSNLFDWIV
Predicted secondary structure















SS confidence





































































Known secondary structure (DSSP)
S
TS

SSTT



 .........360.........370.........380.........390.........400.........410.........420
Sequence ERINKSLKARQPTTNTIGILDIYGFEIFEKNSFEQLCINYVNEKLQQIFIQLTLKAEQEEYAREQIQWTP
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) T

SS





B


SS

TTT




 .........430.........440.........450.........460.........470.........480.........490
Sequence IKYFDNKVVCDLIEQIRPVGIFSAMKDATKTAHADPAACDRTFMQSINGMSHAHLTPRQGNFIIKHYAGD
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)




T
TTTT
T

S



TTTTTT
 .........500.........510.........520.........530.........540.........550.........560
Sequence VTYTVEGITDKNKDQLLKGLLALFQHSGNDFVHTLFPRPVDTDNRKQPPSAGDRIRASANALVDTLMKCQ
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP)
TTS



T


S
GGGGS
SSS



TTS
 .........570.........580.........590.........600.........610.........620.........630
Sequence PSYIRTIKPNENKSPTEYNGPNVLHQIKYLGLQENVRIRRAGFAYRQDFDKFVDRFFLLSPATSYAGEFT
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)


SS

SS


TS
SGGG
TTTTT
 .........640.........650.........660.........670.........680.........690..
Sequence WEGTTEAAVKQILKDTSIPKEEWQMGVTKAFIKAPETLFALEHMRDRYWHNMATRIQRMWRA
Predicted secondary structure












SS confidence





























































Known secondary structure (DSSP)
SS
T

GGG
SS

TT






Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D