Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6uffF_

Fold library idPDB HeaderMoleculeTitle
c6uffF_2.01PDB header: oxidoreductaseChain: F: PDB Molecule: ene-reductase 1;


Added to library: Sat Mar 28 08:32:47 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence NINLFSSYQLGELELPNRIVMAPLTRQRAGEGNVPHQLNAIYYGQRASAGLIIAEATQVTPQGQGYPHTP
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP)


TTS
TTSSS








GGG


TTTSSSSGGG

STT

 .........80.........90.........100.........110.........120.........130.........140
Sequence GIHSPEQVAGWKLVTDTVHQQGGRIFLQLWHVGRISHPDLQPDGGLPVAPSAIAPKGEVLTYEGKKPYVT
Predicted secondary structure













































SS confidence





































































Known secondary structure (DSSP) BSSSTT



TTSS
GGGSTTS


SS



SSTT


 .........150.........160.........170.........180.........190.........200.........210
Sequence PRALDTSEIPAIVEQYRQGAANALAAGFDGVEIHAANGYLIDQFLRDGTNQRTDEYGGAIENRARLLLEV
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)


GGGTT
S

TTS
TTT



STTSSST
 .........220.........230.........240.........250.........260.........270.........280
Sequence TEAITSVWDSQRVGVRLSPSGTFNDIRDSHPLETFGYVAQALNRFNLSYLHIFEAIDADIRHGGTVVPTS
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP) TTTS
GGG
TT

BTTB

SSGGGG

S


TT




 .........290.........300.........310.........320.........330.........340.........350
Sequence HLRDRFTGTLIVNGGYTREKGDTVIANKAADLVAFGTLFISNPDLPERLEVNAPLNQADPTTFYGGGEKG
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) TT

S
SS

TTS
SS
TTTT






GGGSSSSSSTT
 .........360
Sequence YTDYPFLAVA
Predicted secondary structure









SS confidence









Known secondary structure (DSSP) TT
S

GGG


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D