Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6u0oB_

Fold library idPDB HeaderMoleculeTitle
c6u0oB_2.60PDB header: hydrolaseChain: B: PDB Molecule: lyz2 domain-containing protein;


Added to library: Sat Sep 26 08:34:05 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence KGSIFGIIGLVVIFAVVSFLFFSMISDQIFFKHVKSDIKIEKLNVTLNDAAKKQINNYTSQQVSNKKNDA
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)


SGGGTS






SS
TTT



TTSSS
 .........80.........90.........100.........110.........120.........130.........140
Sequence WRDASATEIKSAMDSGTFIDNEKQKYQFLDLSKYQGIDKNRIKRMLVDRPTLLKHTDDFLKAAKDKHVNE
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)


TTTTTT
TTGGGGGB
TTS




TTT
TTT

 .........150.........160.........170.........180.........190.........200.........210
Sequence VYLISHALLETGAVKSELANGVEIDGKKYYNFYGVGALDKDPIKTGAEYAKKHGWDTPEKAISGGADFIH
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP) TTST
TT

SS
TT

SS
TT

S
 .........220.........230.........240.........250.........260.........270.........280
Sequence KHFLSSTDQNTLYSMRWNPKNPGEHQYATDIKWAESNATIIADFYKNMKTEGKYFKYFVYKDDSKHLNKK
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) S

GGG
S
TTSTTSS
S
SBTTTTT




TTTS
 ........
Sequence LAAALEHH
Predicted secondary structure

SS confidence







Known secondary structure (DSSP)



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D