Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6tr4A_

Fold library idPDB HeaderMoleculeTitle
c6tr4A_1.45PDB header: hydrolaseChain: A: PDB Molecule: f5/8 type c domain-containing protein;


Added to library: Sat Oct 31 08:46:48 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence NWIGDENLTGNAEAPAKDDVVPDKNQFRYQKEELAAFCHFGPNTFNEIEWGEHYGNQKPSEIFTLKNDFD
Predicted secondary structure



















































SS confidence





































































Known secondary structure (DSSP)

B
STT










SS





SGGGGTT
SS



TT





S


 .........80.........90.........100.........110.........120.........130.........140
Sequence AETLVKTLKDAGFKKLIVTAKHHDGFCIWDSEHTEYDVKASGYKNKNGESDILAEISKACTDQNMDMGLY
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP) TT


TT

BSS

TT
SSBTGGGT


TTS


TT
 .........150.........160.........170.........180.........190.........200.........210
Sequence LSPWDIHEPSYGYKDEHGNPTTPDKDAKDYNEFYNNQLEEILGNPKYGNDGHFVEVWMAGAKGSGANAQE
Predicted secondary structure













































SS confidence





































































Known secondary structure (DSSP)
S

SS
TTSS
B
TTS
B

GGG
SS
TSTTSSBTTB
S





TT




 .........220.........230.........240.........250.........260.........270.........280
Sequence YDFKKWFKTIQDNEGKAAGYDADCMLFGAEAYTTVRWIGNELGIAGKDTWSKSKVDKDKNTINSNKQGNA
Predicted secondary structure

















































SS confidence





































































Known secondary structure (DSSP)

SGGGT
SS

S
GGG
S
SSSSS


SS

STTTT

TT
 .........290.........300.........310.........320.........330.........340.........350
Sequence TVGFEDGDQWTVPEADARITSGWFWGTKKNTPKTMEELSDMYFNSVGHNATLLLNVPPNNQGTVDKAILD
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP)


TT
S
SSSSSS

TTS




TTBT




TTSS

 .........360.........370.........380.........390.........400.........410.........420
Sequence RVTEFGNNIKATFKTNLAKAEGASVKVSEVRGGAKEYKPGNMIDDNDETYWATSDGKKSGEILIDLGKET
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP) TS

GGGSTT
S

GGG
GGG
GGGGSSS
TT



TT

 .........430.........440.........450.........460.........470.........480.........490
Sequence KFDVVSIEEAIQNGQRINNYKVEYRNGDSGTWTLLEEGKTIGAKRLCRTSETTARQIKITVGTCDGKVPM
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)
GGG




STTSS

S

TT


TT


 .........500......
Sequence ISEIGVYKSTEDMEKP
Predicted secondary structure








SS confidence















Known secondary structure (DSSP)


GGGS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D