Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6torB_

Fold library idPDB HeaderMoleculeTitle
c6torB_2.05PDB header: lyaseChain: B: PDB Molecule: ethanolamine-phosphate phospho-lyase;


Added to library: Sat Apr 18 08:42:51 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence IKIVRAQRQYMFDENGEQYLDCINNVAHVGHCHPGVVKAALKQMELLNTNSRFLHDNIVEYAKRLSATLP
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)

BTTT

SS
TTSTT
BT
TT



SSS

TS
 .........80.........90.........100.........110.........120.........130.........140
Sequence EKLSVCYFTNSGSEANDLALRLARQFRGHQDVITLDHAYHGHLSSLIEISPYKFQVKKEFVHVAPTPDTY
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP) TT

SSS

TT



SSTT
GGG




TT



TT
 .........150.........160.........170.........180.........190.........200.........210
Sequence RGKYREDHADSASAYADEVKKIIEDAHNSGRKIAAFIAESMQSCGGQIIPPAGYFQKVAEYVHGAGGVFI
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) TSSS
TTSS
TT

SSBTTTTSB


TTTT
 .........220.........230.........240.........250.........260.........270.........280
Sequence ADEVQVGFGRVGKHFWSFQMYGEDFVPDIVTMGKPMGNGHPVACVVTTKEIAEAFSSSNTYGGNPVSCAV
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)
TTT
TTTTSS
SSGGGGG
TT


S
GGGGTTSS





SS

 .........290.........300.........310.........320.........330.........340.........350
Sequence GLAVLDIIENEDLQGNAKRVGNYLTELLKKQKAKHTLIGDIRGIGLFIGIDLVKDHLKRTPATAEAQHII
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) TT
TTTTBS
TTT

B
 .........360.........370.........380.........390.........400....
Sequence YKMKEKRVLLSADGPHRNVLKIKPPMCFTEEDAKFMVDQLDRILTVLEEAMGTK
Predicted secondary structure















SS confidence





















































Known secondary structure (DSSP) TT
TTTT



TT

T


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D