Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6tnmA_

Fold library idPDB HeaderMoleculeTitle
c6tnmA_2.95PDB header: oxidoreductaseChain: A: PDB Molecule: fatty acid oxidation complex subunit alpha;


Added to library: Sat Mar 28 09:48:12 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MLYKGDTLYLDWLEDGIAELVFDAPGSVNKLDTATVASLGEAIGVLEQQSDLKGLLLRSNKAAFIVGADI
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)


SSTTT

SSSS
B

TT
TT

SSSSSB
BS
G
 .........80.........90.........100.........110.........120.........130.........140
Sequence TEFLSLFLVPEEQLSQWLHFANSVFNRLEDLPVPTIAAVNGYALGGGCECVLATDYRLATPDLRIGLPET
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) GGTTS
T
SS

STSS
TT



G
 .........150.........160.........170.........180.........190.........200.........210
Sequence KLGIMPGFGGSVRMPRMLGADSALEIIAAGKDVGADQALKIGLVDGVVKAEKLVEGAKAVLRQAINGDLD
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) GGT



SS
T
TS
S

TTSS
 .........220.........230.........240.........250.........260.........270.........280
Sequence WKAKRQPKLEPLKLSKIEATMSFTIAKGMVAQTAGKHYPAPITAVKTIEAAARFGREEALNLENKSFVPL
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP) GGGGS




TTTS
S
TTT

 .........290.........300.........310.........320.........330.........340.........350
Sequence AHTNEARALVGIFLNDQYVKGKAKKLTKDVETPKQAAVLGAGIMGGGIAYQSAWKGVPVVMKDINDKSLT
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) STTTS


SS

STTT


SS
 .........360.........370.........380.........390.........400.........410.........420
Sequence LGMTEAAKLLNKQLERGKIDGLKLAGVISTIHPTLDYAGFDRVDIVVEAVVENPKVKKAVLAETEQKVRQ
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) SS


TTSS
TTGGG
S


S
TS
S
 .........430.........440.........450.........460.........470.........480.........490
Sequence DTVLASNTSTIPISELANALERPENFCGMHFFNPVHRMPLVEIIRGEKSSDETIAKVVAWASKMGKTPIV
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) S


SSS
GGG
S
GGG

SSTTT


SS

TT
 .........500.........510.........520.........530.........540.........550.........560
Sequence VNDCPGFFVNRVLFPYFAGFSQLLRDGADFRKIDKVMEKQFGWPMGPAYLLDVVGIDTAHHAQAVMAAGF
Predicted secondary structure















SS confidence





































































Known secondary structure (DSSP)

TTTTTT

TS

SS


 .........570.........580.........590.........600.........610.........620.........630
Sequence PQRMQKDYRDAIDALFDANRFGQKNGLGFWRYKEDSKGKPKKEEDAAVEDLLAEVSQPKRDFSEEEIIAR
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP) TTTS

SS

TT

BTTTTBSSS

SSS



SS
S




 .........640.........650.........660.........670.........680.........690.........700
Sequence MMIPMVNEVVRCLEEGIIATPAEADMALVYGLGFPPFHGGAFRWLDTLGSAKYLDMAQQYQHLGPLYEVP
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) TTSSS
S


GGG

S
TTTTT
GGGS

 .........710.........
Sequence EGLRNKARHNEPYYPPVEP
Predicted secondary structure










SS confidence


















Known secondary structure (DSSP) TTTT

SS





Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D