Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6t7jB_

Fold library idPDB HeaderMoleculeTitle
c6t7jB_2.43PDB header: oxidoreductaseChain: B: PDB Molecule: carbon monoxide dehydrogenase;


Added to library: Sat Nov 21 08:54:11 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MAEYIKYRVPAKGVSATKGVAELIEKAEEEGIKTAWHRLLEQQPQCAFGQLGVCCRNCAMGPCRIDPFGS
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP)




SS


GGGSBSSTTT



S

TT

SSTT



TTSS
 .........80.........90.........100.........110.........120.........130.........140
Sequence GPTKGVCGAGADTIVARNLLRMIAAGAAAHSDHARDVVEVFKGVAEGRFQYYKLTDVEKLKSLAETLGIS
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) S
SS
TT


TT

TTS



TT

 .........150.........160.........170.........180.........190.........200.........210
Sequence TEGKDEHEIARELAEVLEWEFGKPGDEPLRMLALAPKKRIKVWEKAGVLPRAIDREVCECMHRTHIGVDA
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP)
TT



SSS

GGGGGS
T




TSTTS

 .........220.........230.........240.........250.........260.........270.........280
Sequence DPVSLLLHGIRTSLADGWSGSMMATYLSDILFGTPKPLKAEANLGVLKEDYVNIVVHGHNPILSTKIAEI
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP)
TT




SGGGS
SSS
 .........290.........300.........310.........320.........330.........340.........350
Sequence AMSEEMQKFAKKYGAKGVNVVGMCCTGNEVLMRLGVPIAGSFLMQELAIITGAVEAIIVDYQCIMPAIVD
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) TSTTSS



GGGTS

S
SSS

T
 .........360.........370.........380.........390.........400.........410.........420
Sequence VAQCYHTKVITTEPKGHIPGAVHIEFNAEKADEIAKEIVRIAIENYPNRPRDRVHIPKHKMEAIAGFSVE
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) TTSS

STT


TTS



STTGGG

GGG









 .........430.........440.........450.........460.........470.........480.........490
Sequence AIVEALGGTLEPLINALRDGTIKGIVGIVGCNNPKVKHNYSHVTLAKELIKRDVLVVGTGCWSIAAAMEG
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) TTTSSTSS





TTS
BTTT
T
 .........500.........510.........520.........530.........540.........550.........560
Sequence LMSPKAVDLAGPGLKKICEALNIPPCLHMGSCVDCSRILIALGALADALGVDISDLPAAGSAPEWMSEKA
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) TTSGGGGGGS
T

S

SSTTTT

GGGSSTT

S
 .........570.........580.........590.........600.........610.........620.........630
Sequence VSIGTYFVASGVFTHLGVVPPVMGSQKVAKILTEDVEDIIGGKFYVEPDPVKAAETIYNVILEKRKKLGW
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP) TT

SS

TTTT
TTTS




TT
 ..
Sequence PL
Predicted secondary structure

SS confidence

Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D