Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6t6nE_

Fold library idPDB HeaderMoleculeTitle
c6t6nE_2.50PDB header: biosynthetic proteinChain: E: PDB Molecule: 3-oxoacyl-[acyl-carrier protein] reductase;


Added to library: Sat Nov 21 09:16:51 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MALASKTAIVTGAARGIGFGIAQVLAREGARVIIADRDAHGEAAAASLRESGAQALFISCNIAEKTQVEA
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)
TTTT
TTTSTT
SSTTTT



TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence LFSQAEEAFGPVDILVNNAGINRDAMLHKLTEADWDTVIDVNLKGTFLCMQQAAIRMRERGAGRIINIAS
Predicted secondary structure




















































SS confidence





































































Known secondary structure (DSSP)
S








B
TTT

TT


 .........150.........160.........170.........180.........190.........200.........210
Sequence ASWLGNVGQTNYSASKAGVVGMTKTACRELAKKGVTVNAICPGFIDTDMTRGVPENVWQIMISKIPAGYA
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP) GGGG

TTBGGGT
SB
SSS
TSTTSS
 .........220.........230.........240....
Sequence GEAKDVGECVAFLASDGARYINGEVINVGGGMVL
Predicted secondary structure












SS confidence

































Known secondary structure (DSSP) B
SGGGTT

S
STT



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D