Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6t3wA_

Fold library idPDB HeaderMoleculeTitle
c6t3wA_1.82PDB header: viral proteinChain: A: PDB Molecule: 2c protein;


Added to library: Sat Nov 21 08:44:36 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence KCRIEPVCLLLHGSPGAGKSVATNLIGRSLAEKLNSSVYSLPPDPDHFDGYKQQAVVIMDDLCQNPDGKD
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)

S




TTSSTT



SSSSTTTT



S
SS

 .........80.........90.........100.........110.........120.........130.........140
Sequence VSLFCQMVSSVDFVPPMAALEEKGILFTSPFVLASTNAGSINAPTVSDSRALARRFHFDMNIEVISMYSQ
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) SSS




S
GGGT







SS
SS


SS
S
GGG
 .........150.........160.........170.........180.........190.........200........
Sequence NGKINMPMSVKTCCPVNFKKCCPLVCGKAIQFIDRRTQVRYSLDMLVTEMFREYNHRHSVGTTLEALF
Predicted secondary structure















SS confidence



































































Known secondary structure (DSSP) TT
S



SSSSS

TSSTTT


STT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D