Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6skiF_

Fold library idPDB HeaderMoleculeTitle
c6skiF_2.60PDB header: hydrolaseChain: F: PDB Molecule: putative type vi secretion protein;


Added to library: Sat Apr 18 08:27:50 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence KYQGYDVTDATHKTSIHNDWKVVVAKKKPARGVTLTIGIFFDGTGNNRENTASRLMKFNECSAARQGVNQ
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)
S





SSS








S
SSB

TTTTTBTTTTT

 .........80.........90.........100.........110.........120.........130.........140
Sequence KDAQSCEDFLKEINSYRGYYSNIHWLNILYHPDQVLKKDQTSAQIKTYISGIGTGMGLGTSILDIFEGVV
Predicted secondary structure














































SS confidence





































































Known secondary structure (DSSP)


B


BB



S

TT



S


T
 .........150.........160.........170.........180.........190.........200.........210
Sequence TKTDEAMERITQALSEFMGFNLSPDFCIAKIQFDVFGFSRGAAAARHFANRVMEQDPAIARAIAKGLRGD
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP) S
S
S
TTT
TT
 .........220.........230.........240.........250.........260.........270.........280
Sequence FYDGKPSGEVRFLGLFDTVAAIGGISNFFDINGRSNPGVKLELRPSVAKKVFQITAMNEYRYNFSLNSIK
Predicted secondary structure















































SS confidence





































































Known secondary structure (DSSP)
B
S
TT
S


S
SS
STTBTTTTTS









TTS
STT

BSS


T
 .........290.........300.........310.........320.........330.........340.........350
Sequence GMWPELALPGAHSDIGGGYNPVGSPLQENESLFLSCPEFEIVSDDTREMDTRVYRKAEQVRKMLMTLPAL
Predicted secondary structure










































SS confidence





































































Known secondary structure (DSSP) TTS
SS
STTTSB



TTSTT


SS

TTS
GGGSTT
STT
 .........360.........370.........380.........390.........400.........410.........420
Sequence KHILPHGKLTTKIRSIGVNNSNQRRAGVIQKQVGAAVFFERMAVPNDWANVCLRVMLDAAQEAGVLFEPI
Predicted secondary structure
















































SS confidence





































































Known secondary structure (DSSP) TTTGGGS

T






TT

B


 .........430.........440.........450.........460.........470.........480.........490
Sequence RQTNTELQLPSELIFLADKAIAQGKAVRLGQEPQAFTEEELYIIGKYTHCSANWNIESDGNLWVDPTTGE
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP)
TT
SSS


GGGTTS





TT








SS
TTT

 .........500.........510.........520.
Sequence IFIHRFGPKGNKAFVFPNKPNDRWIRSVWYM
Predicted secondary structure





















SS confidence






























Known secondary structure (DSSP)
TTS

S


TT
B
GGG




Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D