Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6s9fB_

Fold library idPDB HeaderMoleculeTitle
c6s9fB_1.97PDB header: signaling proteinChain: B: PDB Molecule: tyrosine-protein kinase-like otk;


Added to library: Sat Mar 28 09:57:31 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence ALPAAPEDLRIVQGPIGQSIIKEGEPTALTCLYELPDELKNQRIQLRWRKDGKLLRQVELGGSAPREDAR
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP)





TT



STT





GGGTTS
TT
SS



 .........80.........90.........100.........110.........120.........130.........140
Sequence LVLHKQNGTLSFASIIASDAGQYQCQLQLEAHAPINSSPGILEVIEQLKFVPQPTSKNLELDAVVAKVHC
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)
TTT

SS

GGG
TTS






SSS



TT
S

 .........150.........160.........170.........180.........190.........200.........210
Sequence KAQGTPTPQVQWVRDGENTTLPDHVEVDANGTLIFRNVNSEHRGNYTCLATNSQGQINATVAINVVVTPK
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP)

SS

SS

S

TT
TTS
S

GGG

SS
 .........220.........230.........240.........250.........260.........270.........280
Sequence FSVPPVGPIETSEQGTVVMHCQAIGDPKPTIQWDKDLKYLSENNTDRERFRFLENGTLEIRNVQVEDEGS
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP)






SS



S

TT

SSSS
TTT
TTS

S

GGG
 .........290.........300
Sequence YGCTIGNSAGLKREDVQLVV
Predicted secondary structure


SS confidence



















Known secondary structure (DSSP) TT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D