Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6rowC_

Fold library idPDB HeaderMoleculeTitle
c6rowC_4.50PDB header: hydrolaseChain: C: PDB Molecule: putative zinc metallopeptidase;


Added to library: Sat Mar 28 08:41:45 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence NANRSKEWKNAANTLLFGLDESVDPCEDFYGFTCNKFIERIDFTTFSQAQLEVNSDIVKALEKSQTERIT
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)






SSS
TTT
TTS



SST


 .........80.........90.........100.........110.........120.........130.........140
Sequence KAAFQSCVEYTLKDDRKASVNELLQYISERFGGIPFLYREMGRIEQQRALPTFMYTWVNVDHKNVSRNSY
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP) SGGGGTTT


TT


STTT



S

SSSTTB
 .........150.........160.........170.........180.........190.........200.........210
Sequence YISQPTLPMPREFYVLPQFAPELDARTKAIENVMKAFASDILKYDKMIKTAAREVTQIEQKIAMASWPDD
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP)



SS
S

SS
TTTTTTT






TS

TT
 .........220.........230.........240.........250.........260.........270.........280
Sequence ELRNHEQQYNPYELFAPSEGFGKYIAGLMETVFIGDVIVTNPAYMGFNYIIVHMLFEDAARMKCVDTITT
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP) TTT
TTTS

B

TTTGGG

T








B

S







TT



 .........290.........300.........310.........320.........330.........340.........350
Sequence YMPYGTGYVYVNSREDRDQVVEDVKQQTELIMKTFLKKMLSTLSWMQGESYRRAEKKINEMHRNYGWPKK
Predicted secondary structure









SS confidence





































































Known secondary structure (DSSP)




TTS



SS
TT
 .........360.........370.........380.........390.........400.........410.........420
Sequence LFGDDYYSILEAYNNKTDKSYTILNILRRGYENRESFRRKNETADRTNFLESPASVNAWYAPELNSLTLP
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP) S


TTT
S






TTSSB

S


SS
SSS


TTTT

 .........430.........440.........450.........460.........470.........480.........490
Sequence HYDLQFPKAFNFAGSGTVGGHELVHGFDDEGVQFKGKNGFKDMAQCVVTQYNAQCCPHCANGAHTQGENI
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP)



S

TTTSTTGGG

TTTTS






STTSTTT
 .........500.........510.........520.........530.........540.........550.........560
Sequence ADLGGLQASYNAYKEYIEMRLPGLEKFTPNQIFWISYGYSWCAKETQSSLVKRLLTNPHSPNSCRVNQVL
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP) T




SS

SS
TT




STTTSSSS

TT
 .........570.........580...
Sequence QDIPSFAKDFQCALGQKMYCKVW
Predicted secondary structure











SS confidence






















Known secondary structure (DSSP) TT
SGGGGGS


S
SS






Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D