Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6rbgD_

Fold library idPDB HeaderMoleculeTitle
c6rbgD_3.00PDB header: membrane proteinChain: D: PDB Molecule: chain length determinant protein;


Added to library: Sat Nov 21 08:43:14 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence DLIDLLVQLWRGKMTIIISVIVAIALAIGYLAVAKEKWTSTAIITQPDVGQIAGYNNAMNVIYGQAAPKV
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP)

SSSTTT
TTT


B



TTTSTTGGG


T
 .........80.........90.........100.........110.........120.........130.........140
Sequence SDLQETLIGRFSSAFSALAETLDNQEEREKLTIEPSVKNQQLPLTVSYVGQTAEGAQMKLAQYIQQVDDK
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP) TTTTTTSSSSTTSSS


SSSSSS
S
SSSSTTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence VNQELEKDLKDNIALGRKNLQDSLRTQEVVAQEQKDLRIRQIQEALQYANQAQVTKPQIQQTGEDITQDT
Predicted secondary structure
SS confidence





































































Known secondary structure (DSSP) TTSTTTTT

S





SS


SGG
 .........220.........230.........240.........250.........260.........270.........280
Sequence LFLLGSEALESMIKHEATRPLVFSPNYYQTRQNLLDIESLKVDDLDIHAYRYVMKPMLPIRRDSPKKAIT
Predicted secondary structure
















SS confidence





































































Known secondary structure (DSSP) GGGG
SS
TTS




TT

SSS










SS
SB

TT
 .........290.........300........
Sequence LILAVLLGGMVGAGIVLGRNALRNYNAK
Predicted secondary structure




SS confidence



























Known secondary structure (DSSP) S


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D