Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6r5nA_

Fold library idPDB HeaderMoleculeTitle
c6r5nA_2.00PDB header: hydrolaseChain: A: PDB Molecule: periplasmic beta-glucosidase;


Added to library: Sat Apr 18 08:44:35 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence TDKERFIASLMARMSNAEKIGQLRLVSVGADHPKEALMADIRAGKVGAIFNTVTRPDIRAMQDQVRHSRL
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)
T

TT
SBTTB
TT


S

STTSSS
 .........80.........90.........100.........110.........120.........130.........140
Sequence KIPLFHAYDVAHGHRTIFPISLGLAASWDPEVVARSARISALEASADGLDMSFSPMVDITRDARWGRVSE
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)





SSBSSSB


TT

TT

S

B





TTSGGGGG
 .........150.........160.........170.........180.........190.........200.........210
Sequence GFGEDTYLTSLLSGVMVRAYQGSNLAAPDSIMAAVKHFALYGAAEGGRDYNTVDMSLPRMFQDYLPPYKA
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP) S

S
TT
TTSTT

TTGGG
GGG
TT

B


TS
 .........220.........230.........240.........250.........260.........270.........280
Sequence AVDAGAGAVMVSLNTINGVPATANRWLLTDLLRQQWGFKGLTISDHGAVKELIKHGLAGNERDATRLAIQ
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) TT
S
SSTTGGG
T





T


S

TTTTGGGTTTTS
SS
 .........290.........300.........310.........320.........330.........340.........350
Sequence AGVDMNMNDDLYSTWLPKLLAAGEIDQADIDRACRDVLAAKYDLGLFADPYRRLGKPDDPPFDTNAESRL
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP) T

BSS
TTSS
TTTTT
TTTTS

TT




TT
GGG
 .........360.........370.........380.........390.........400.........410.........420
Sequence HRQAAREVAREGLVLLKNRDGLLPLKKQGRIAVIGPLAKSQRDVIGSWSAAGVPRQAVTVYQGLANAVGE
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP)

GGG

S

S
SSTTTT
T
SS
TT

GGGS

TT
 .........430.........440.........450.........460.........470.........480.........490
Sequence RATLLYAKGANVSGDQAILDYLNSYNPEVEVDPRSAEAMLEEALRTARDADLVVAVVGESQGMAHEASSR
Predicted secondary structure













































SS confidence





































































Known secondary structure (DSSP) SS

S
S
S
TSSS

S



S
TSS

GGGSSTT


 .........500.........510.........520.........530.........540.........550.........560
Sequence TDLRIPASQRRLLKALKATGKPLVLVLMNGRPLSLGWEQENADAILETWFSGTEGGNAIADVLFGEHNPS
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP) S

SS
TTT


SS




S

S

TTTTSS


 .........570.........580.........590.........600.........610.........620.........630
Sequence GKLTMSFPRSVGQVPVYYNHLNTGRPMDHDNPGKYTSRYFDEANGPLYPFGYGLSYTEFSLSPLRLSSER
Predicted secondary structure





















































SS confidence





































































Known secondary structure (DSSP)


SS
B
SSGGG



SS



SS


SSS

SSSSS
SSS

S
SB
TT

B
SS



S
S
 .........640.........650.........660.........670.........680.........690.........700
Sequence LARGATLEARVTLSNSGKRAGATVVQLYLQDPVASLSRPVKELRGFRKVMLEPGESREIVFRLGEADLKF
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)
TT


SSS


S
SS


S

TT

GGGG
 .........710.........720.........730...
Sequence YDSQLRHTAEPGEFKVFVGLDSAQTESRSFTLL
Predicted secondary structure
















SS confidence
































Known secondary structure (DSSP)
TT



SSSSSS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D