Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6qxpE_

Fold library idPDB HeaderMoleculeTitle
c6qxpE_3.20PDB header: plant proteinChain: E: PDB Molecule: leucine-rich repeat extensin-like protein 2;


Added to library: Sat Mar 28 09:50:52 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence KVDPSLKFENPSLRQAYIALQSWKQAIFSDPFNFTANWNGSDVCSYNGIFCAPSPSSPKTRVVAGIDLNH
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP)


TT


SS
SS
SGGG

SS
GGGSTT
SS
TTS
TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence ADMAGYLPRELGLLTDLALFHLNSNRFCGEVPLTFKHMKLLFELDLSNNRFVGKFPNVVLSLPSLKFLDL
Predicted secondary structure





























































SS confidence





































































Known secondary structure (DSSP)




GGGGG
TT


TT



GGGGG
TT



SS

T
TT


 .........150.........160.........170.........180.........190.........200.........210
Sequence RYNEFEGSIPSKLFDKELDAIFLNHNRFMFGIPENMGNSPVSALVLADNDLGGCIPGSIGLMGKTLNEII
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP)
SS

TS

S
TTSS


TTGGG


S

SSB

B


GGGGGGGTT

 .........220.........230.........240.........250.........260.........270.........280
Sequence LSNDNLTGCLPPQIGNLKNVTVFDISFNRLSGPLPSSIGNMKSLEQLNVANNRFTGVIPSSICQLSNLEN
Predicted secondary structure

































































SS confidence





































































Known secondary structure (DSSP)
TTS
B


GGGGG
TT



SS

GGGGG
TT



SSS


GGGGG
SS

 .........290.........300.........310.........320.........330.........340....
Sequence FTYSSNFFTGDAPRCVALLGVVVNGSMNCIDGKEDQRSSKECSSPARSVDCSKFGCNNFFSPLE
Predicted secondary structure
















































SS confidence































































Known secondary structure (DSSP)

SS

S





SGGG




SS

TT
SS


TSS
S


SSSSS



SS



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D