Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6qvmA_

Fold library idPDB HeaderMoleculeTitle
c6qvmA_2.50PDB header: oxidoreductaseChain: A: PDB Molecule: multiheme cytochrome cf;


Added to library: Sat Mar 28 09:01:43 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence TEQYAKDTGKNCSYCHQVPASHKSQPGQQGRDQMDCMACHKAFMPLTSTAQIPLTERGVLFMQNGKKLAV
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP)
T

B


GGG


TT


GGGS
TTTS



TTTS
B
TTS



 .........80.........90.........100.........110.........120.........130.........140
Sequence DLNYDPLTEANVVKEFARVSGLSESAFGKVSGNITKQRLAYFLMVALKAQGEVAKVTANDLKKYADYTKA
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP)
TTTS

BT

GGGG



SB
BTT
TT

TTSTTGGGS
 .........150.........160.........170.........180.........190.........200.........210
Sequence ASANQKALVWAVKKGYLSARKAGSKLYLDPTAAASRTEVVKAFNAVQAKYPRVLPAPTAYAGTKKCQSCH
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)
TTSS

TT

TTSB

S





TT



 .........220.........230.........240.........250.........260.........270.........280
Sequence GFSKFSATWHPNMVKTPDFFGSMLLWSLNDKFQASDVRYVINSPTELLFVGKDYKYMPYAFDKAENQWVA
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP)

GGGGGSSGGGS
GGGGTTTT
GGG
SS

GGG
SSTTSBB
STTTT
 .........290.........300.........310.........320.........330.........340.........350
Sequence DSHTQNWLVSCAKCHVTGYPGPNGITGTPYSVVGNTYKELFTEPGIGCEACHGPGALHAATGDPTKILGE
Predicted secondary structure




























































SS confidence





































































Known secondary structure (DSSP)



SBTGGGT

SS

STT


TT

SS

T


TT

GGGS

G
 .........360.........370.........380.........390.........400.........410.........420
Sequence KDGIAASATCEKCHEGAHHRGGEYNDEYAIAGVSGTVYGKHGISLQTIQKNSHGSVSCLECHSQDYRTAL
Predicted secondary structure





























































SS confidence





































































Known secondary structure (DSSP) GGTTTSTTTS
SSSSTTGGGGSTTS
S

TTTTT
TT

SGGGGTT
 .........430.........440.........450.........460.........470.........480.........490
Sequence EDYLKANPGKTAADFNATVKLSDFKLGITCVTCHSPHSEKGYGKQLRKEPNELCMECHTGEGFTATSGSK
Predicted secondary structure

























































SS confidence





































































Known secondary structure (DSSP) STT

STTTGGG

GGG



S
B
SS


SSSTTBSS
S


S

TT

GG
 .........500.........510.........520.........530.........540.........550.........560
Sequence GVHHPQKEVFTGQLGASFTALGIPEKVYNPMGSAECVTCHMPNGYHYFKVGKPTISIDNLTIKNDSSLGS
Predicted secondary structure



































































SS confidence





































































Known secondary structure (DSSP) G



T


GGGGGGT

S



TTTTS
SGGG






SST
GGGGG
 .........570.........580.........590.........600.........610.........620.........630
Sequence YQSRYKASYNSCSVCHDAVGFDANAVKAWTDKVDTRVNNILNQLKTTYAAAYNDPNYKYADTLAGIVAAD
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) GTT

SSTTTS
TTTS
STTTT
TT
TTTS
 .........640.........650........
Sequence ASHGIHNTALTELLLDKAEYYLTQIPKQ
Predicted secondary structure










SS confidence



























Known secondary structure (DSSP)
STTGGGTTTTTS



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D