Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6q1rD_

Fold library idPDB HeaderMoleculeTitle
c6q1rD_2.70PDB header: transferaseChain: D: PDB Molecule: probable amino acid aminotransferase;


Added to library: Sat Sep 26 08:36:23 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence NAMVVTLDGEILQPGMPLLHADDLAAVRGDGVFETLLVRDGRACLVEAHLQRLTQSARLMDLPEPDLPRW
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)

TTS
B

TT


S
TTBS

TTSSTT




 .........80.........90.........100.........110.........120.........130.........140
Sequence RRAVEVATQRWVASTADEGALRLIYSRGREGGSAPTAYVMVSPVPARVIGARRDGVSAITLDRGLPADGG
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)
SS


BTT







S

TT
 .........150.........160.........170.........180.........190.........200.........210
Sequence DAMPWLIASAKTLSYAVNMAVLRHAARQGAGDVIFVSTDGYVLEGPRSTVVIATPCLLTPPPWYPILRGT
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP)
GGG
TTS
BS

TT
S
TTSBB


SSS



TTSSS


 .........220.........230.........240.........250.........260.........270.........280
Sequence TQQALFEVARAKGYDCDYRALRVADLFDSQGIWLVSSMTLAARVHTLDGRRLPRTPIAEVFAELVDAAIV
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) TT



BTSS
SSS
TT



TTT
 ...
Sequence SDR
Predicted secondary structure

SS confidence


Known secondary structure (DSSP) TT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D