Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6pcmB_

Fold library idPDB HeaderMoleculeTitle
c6pcmB_3.11PDB header: isomerase/dnaChain: B: PDB Molecule: dna topoisomerase 1;


Added to library: Sat Mar 28 08:40:17 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence NVRRLVIVESPTKARKIAGYLGSNYVVESSRGHIRDLPRNAADVPAKFKSEPWARLGVNVDQNFEPLYIV
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP)


S
S
SS

S
S

SSTTTS
GGGTTSGGGTTTTTTT


 .........80.........90.........100.........110.........120.........130.........140
Sequence SPEKKSTVTELKGLLKDVDELYLATDGDREGEAIAWHLLETLKPRVPVKRMVFHEITEPAIRNAAENPRD
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP)
STTTT





SSS


S



S

SS
B
 .........150.........160.........170.........180.........190.........200.........210
Sequence LDIALVDAQETRRILDRLYGYEVSPVLWKKVAPKLSAGRVQSVATRIIVQRERERMAFHSASYWDVTAEL
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP)

T
TT



TTT



 .........220.........230.........240.........250.........260.........270.........280
Sequence DASVSDPSASPPKFTAKLNTVDGRRVATGRDFDSLGQLKRPDEVLVLDEASAGALASGLRGAQLAVTSVE
Predicted secondary structure


















































SS confidence





































































Known secondary structure (DSSP)
TTT
S

SS
TT

TTTB
SSSSBSSTTT


TTT


 .........290.........300.........310.........320.........330.........340.........350
Sequence QKPYTRRPYAPFMTSTLQQEAARKLRFSSERTMSIAQRLYENGYITYMRTDSTTLSESAINAARTQARQL
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP)






B
S


TTSB

SS






 .........360.........370.........380.........390.........400.........410.........420
Sequence YGEEYVHPSPRQYTRKVNAQEAHEAIRPAGDVFQTPGQLHSALDTDEFRLYELIWQRTVASQMADARGTT
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP) T
STTB
SS












S

B
B
SSS


GGGGTTTS
TTB

 .........430.........440.........450.........460.........470.........480.........490
Sequence LSLRIGGSASSGEQVVFNASGRTITFPGFLKAYVSRLPNLTQGQRVDAADLSADGHQTSPPARYTEASLI
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)


TTS


GGGGT








TT








 .........500.........510.........520.........530.........540.........550.........560
Sequence KALEELGIGRPSTYSSIIKTIQDRGYVQKKGSALVPSWVAFAVVGLLEQHFGRLVDYDFTAAMEDELDEI
Predicted secondary structure
















SS confidence





































































Known secondary structure (DSSP) T


TTTTTSTT
S
 .........570.........580.........590.........600.........610.........620.........630
Sequence ANGQEQRTNWLNNFYFGGEHGVEGSIARAGGLKQLVGGNLEGIDAREVNSIKVFDDSEGRPVYVRVGRNG
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) TSS
T

S

STT
STTTT
GGGTT

B



TTS

STT
 .........640.........650.........660.........670.........680.........690.........700
Sequence PYLERMVDDPDNQKPQRANLKEDLTPDELTPELAEKLFATPQEGRSLGIDPETGHEIVAKDGRFGPYVTE
Predicted secondary structure
















































SS confidence





































































Known secondary structure (DSSP) S

S




TT

GGG

S
SSS
TTT

TT
 .........710.........720.........730.........740.........750.........760.........770
Sequence VLPETGPKPRTGSLFRSMDLETVTLEDALKLLSLPRVTTNEEITAQNGRYGPYLKRGTDSRSLATEDQIF
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP)














SS

TTT

T
SB


SS
TTTT


TT
 .........780...
Sequence TITLDEALKIYAE
Predicted secondary structure



SS confidence












Known secondary structure (DSSP) TTSTTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D