Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6p8tE_

Fold library idPDB HeaderMoleculeTitle
c6p8tE_3.15PDB header: ligaseChain: E: PDB Molecule: phenylalanine--trna ligase beta subunit;


Added to library: Sat Nov 21 08:50:21 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MKISENWLRTWVNPAIDSDTLSDQLTMLGLEVDELASVAKPFTGVVVGEVLTVEQHPDADRLRVTTVNIG
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)
TT





TTT
SS





SS



S
 .........80.........90.........100.........110.........120.........130.........140
Sequence SGEPLQIVCGAPNVRAGMKAPVATIGAVLPGDFKIKKGKLRGVESQGMLCGASEIDLEDKIDGLLELPAD
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP) SSS


TT

TT
TTT



BSSS
B



BSGGGTS

SSSSB



TT
 .........150.........160.........170.........180.........190.........200.........210
Sequence APVGVNIREYLKLDDNVIDISITPNRGDCFSIRGIAREVAVINQLQMNEPEIKSVDATITDEKKVVINTD
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)

TTSBTTTT


TT
GGGSSTT













S





SS
 .........220.........230.........240.........250.........260.........270.........280
Sequence GAPRYLGRVIKNVNVKAATPEWMEQALARSGIRTHSILVDVTNYVLMELGQPMHAFDLAKIEGTVHVRQA
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) S
SS

TT



TTT




TS


GGG

SS
 .........290.........300.........310.........320.........330.........340.........350
Sequence KPQEKLQLLNDQEVELQEDVMVIADDQKALAIAGIMGGLASSVTDDTTDIFLESAFFAPLAIAGRARRFG
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)
TT
BTTS


TTS
SSSTTTBTTTB

TT




B

TTTTGGGT
 .........360.........370.........380.........390.........400.........410.........420
Sequence LHTDSSQRYERGVDFELPVIAMNRASQLIQELAGGEFGPITVAEKSDLLPKREAIELKQAQVDQLLGYKV
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)


S


TT
T


GGGS




SS

 .........430.........440.........450.........460.........470.........480.........490
Sequence AAEFITDALTRLGCEVTVQANGEWSVVPPSHRYDMAIYQDLIEEVARIDGYDNIQISLPSMDVQLAKYQD
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP)
TT
TTT

TT
SS

S
GGG
















 .........500.........510.........520.........530.........540.........550.........560
Sequence RFEIAQLRQTVATLGYQEAISFSFADAKLEKQLNPQVSPLMLANPISSDLAAMRSTLLSSLIPCVQYNLN
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) B

TT




S

TT



B
SS
SSGGG

SSTT
 .........570.........580.........590.........600.........610.........620.........630
Sequence RQQSRVRFFELGLRFDYQNANSIQDLKQIPTLALVAVGSREPESWHAKPQPMDFFDFKGEVEEILAAGRV
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) TT



TT
SSGGG
SBSS

BTTB


B

TTT
 .........640.........650.........660.........670.........680.........690.........700
Sequence KVEYVRSERPWLHPGQSAEILVDGQSIGYLGRLHPSLENELDLSTTWVAELDQAAVLQSYVSNFTELSRF
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)




TTTT
TT

SS
B








SS
 .........710.........720.........730.........740.........750.........760.........770
Sequence PSVRRDIALLISDNINVRDIQQLIEKTGGELLDSTWLFDVYTGQGVEEGKRSLAFALLWQHPSRTLEDAE
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)

TTS

SS
STT

TT

SS


SSTT
 .........780.........790...
Sequence IKSGMDNIIQVLENTYQATLRAS
Predicted secondary structure


SS confidence






















Known secondary structure (DSSP) S





Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D