Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6p8tC_

Fold library idPDB HeaderMoleculeTitle
c6p8tC_3.15PDB header: ligaseChain: C: PDB Molecule: phenylalanine--trna ligase alpha subunit;


Added to library: Sat Nov 21 08:47:06 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MRVTMSLEALTTEALAAIAAAQDLVALDQVRVQFTGKKSQLAEQSKALGKMDPEERKVQGAAIHAVRETI
Predicted secondary structure











SS confidence





































































Known secondary structure (DSSP)







STTTTSS
TTS
TTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence NNALTERQTALQQAALAQKLASETIDITLPGRGQRIGTVHPVTQVQERICQFFTKAGFTVATGPEVEDDY
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) T


TTS

SS






TTT




S
 .........150.........160.........170.........180.........190.........200.........210
Sequence HNFEALNIDTFYFDANHLLRTHTSGVQIRTMETSQPPIRIVCPGRVYRCDSDQTHSPMFHQIEGLYVAEN
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) TGGGT



BSSSS
SSTS

S



S

SSS

SS
 .........220.........230.........240.........250.........260.........270.........280
Sequence TSFAELKGLLINLLNEFFEKDLKVRFRPSYFPFTEPSAEVDIMDERGRWLEVLGCGMVHPNVLRAAGIDP
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)

TTS


TT
SSS

T

T
 .........290.........300.........310.........320
Sequence DKYKGFAFGLGVERFAMLRYGINDLRMFYQNDVRFLRQFA
Predicted secondary structure









SS confidence







































Known secondary structure (DSSP) TT
T


TT

TT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D