Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6ok3A_

Fold library idPDB HeaderMoleculeTitle
c6ok3A_2.35PDB header: hydrolaseChain: A: PDB Molecule: sel1 repeat protein;


Added to library: Sat Apr 18 08:56:16 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence EENANKIILDEEAVIQCNERYKTENDEKGDEETVSWCRKAASGNAEAQYLFGXLVYDGRGVQQDNCVAXL
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)




TS






TSSS


 .........80.........90.........100.........110.........120.........130.........140
Sequence WWXKAAEQNHAALVXLGNLHRKGQCIAENYPKAIAYWKRAAVQNNVWAYHNLGTAYYDGIGVDNPHEAVR
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) TT


T
SS


TTT
TSS


 .........150.........160.........170.........180.........190.........200.........210
Sequence WWAAELGFPESQNNLGALYNDGNGVDRDYQEAVFWYRSALQGDELGQYNLGVAYYYGRGIKKDFSEAVSW
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)

TTTT

SSS




GGGT
TSSS


 .........220.........230.........240.........250.........260.........270.........280
Sequence YKKSAEQDYAQAQHNLGVTYYEGEGIKKDYAKAVYWWAAEQGIPQSQYNLGIAYEEGWGAEKNPENAVFW
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) TTT
TSSS




TTTT
TSSS


 .........290.........300.........310.........320.........330.........340.........350
Sequence YRAAEQGHADAQNRLGIAYRYGTGVRKNPALSVKWLEKAAKQGLARAQFNLGKTFYIGAGINKNTDKAVY
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)

GGGT
TSSS


TT
TSSS


 .........360.........370.........380.........390.........400.........410.........420
Sequence WFIKAANQGFTEAQAYIGXIYFGKYVANEKKGFYWLKKAAEKDSAAQAFLGALYIAGNEVKPNIKEGVAL
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) TT



S


TT



SSS


 .........430.........440.........450.........460.........470.........480.........490
Sequence TKKAALQGNYEAQTLLGFCYENGLEVKKDLIAAYALYLSASPHFDFAEKARLDLERKLSEQEIAKAISVN
Predicted secondary structure















SS confidence





































































Known secondary structure (DSSP) TT
TSSS


TTT
S


 ......
Sequence TAKLFE
Predicted secondary structure


SS confidence





Known secondary structure (DSSP) TTGGG


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D