Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6ok0A_

Fold library idPDB HeaderMoleculeTitle
c6ok0A_2.17PDB header: hydrolaseChain: A: PDB Molecule: sel1 repeat protein;


Added to library: Sat Apr 18 08:46:03 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence APVAVTSYAQQPLKLVQEASDGDGSAELELGLRYVFGSDGVKNVPLGVSWINAALKGIPQAEHEXGSLYL
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP)





TTTT



TT

S
TTT



GGGT
 .........80.........90.........100.........110.........120.......
Sequence XGIGVAQSNVXAVAWYRAAIQGYAPSQTAXGYAYEEGAGVPQDADLARYWFDAAAQG
Predicted secondary structure











SS confidence
























































Known secondary structure (DSSP) TSSS




TTTT
TSSS




GGG


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D