Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6lypB_

Fold library idPDB HeaderMoleculeTitle
c6lypB_3.30PDB header: membrane proteinChain: B: PDB Molecule: mechanosensitive ion channel protein 1, mitochondrial;


Added to library: Sat Apr 18 08:35:06 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence FWGALEDPARYLVTFIAFAQIAAMVAPTTAIAQYFSPTVKGAVILSLVWFLYRWKTNVITRMLSAKSFGG
Predicted secondary structure







SS confidence





































































Known secondary structure (DSSP)
TTTSTTTTS



SS
STTTSSTTTGGGTTTTTTTS
S
 .........80.........90.........100.........110.........120.........130.........140
Sequence LDREKVLTLDKVSSVGLFAIGLMASAEACGVAVQSILTVGGVGGVATAFAARDILGNVLSGLSMQFSRPF
Predicted secondary structure








SS confidence





































































Known secondary structure (DSSP) S
TSSSTTSSSSTTTSTTS


 .........150.........160.........170.........180.........190.........200.........210
Sequence SMGDTIKAGSVEGQVIEMGLTTTSLLNAEKFPVLVPNSLFSSQVIVNKSRAQWRAIASKIPLQIDDLDMI
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP)
TT

SSS


SSTTS
TSS




SS

S


B

S
SSS
 .........220.........230.........240.........250.........260.........270.........280
Sequence PQISNEIKEMLRSNTKVFLGKEAPHCYLSRVEKSFAELTIGCNLIRMGKEELYNTQQEVLLEAVKIIKKH
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP) TSSSB

SSS



SSBB
S

SST
 .......
Sequence GVSLGTT
Predicted secondary structure






SS confidence






Known secondary structure (DSSP) T




Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D