Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6lxeA_

Fold library idPDB HeaderMoleculeTitle
c6lxeA_4.20PDB header: hydrolase/rna binding proteinChain: A: PDB Molecule: ribonuclease 3;


Added to library: Sat Apr 18 08:32:19 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence VWIRCTHSENYYSSDPMDQVGDSTVVGTSRLRDLYDKFEEELGSRQEKAKAIAEIKRKKAHPDRLHDELW
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP)





S
SB

TTT

SS


B

S

S







SSTTTSS
SS
SSSSS
 .........80.........90.........100.........110.........120.........130.........140
Sequence YNDPGQMNDGPLCKCSAKARRTGIRHSIYPGEEAIKPCRPMTNNAGRLFHYRITVSPPTNFLTDRPTVIE
Predicted secondary structure



















































SS confidence





































































Known secondary structure (DSSP)


TT

SSS
S

S
SS
TTT
GGGT

TT





S
SSS

STTSSS
TTT

S



B
 .........150.........160.........170.........180.........190.........200.........210
Sequence YDDHEYIFEGFSMFAHAPLTNIPLCKVIRFNIDYTIHFIEEMMPENFCVKGLELFSLFLFRDILELYDWN
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) SSS

BB


SS







SSS





S

TTTS


S

 .........220.........230.........240.........250.........260.........270.........280
Sequence LKGPLFEDSPPCCPRFHFMPRFVRFLPDGGKEVLSMHQILLYLLRCSKALVPEEEIANMLQWEELEWQKY
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) SS

SSS






S


B


SSS


TT





SSS
S
 .........290.........300.........310.........320.........330.........340.........350
Sequence AEECKGMIVTNPGTKPSSVRIDQLDREQFNPDVITFPIIVHFGIRPAQLSYAGDPQYQKLWKSYVKLRHL
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP) TT
S

TTSS


S







TTS




B







SSTT
S

SS
 .........360.........370.........380.........390.........400.........410.........420
Sequence LANSPKVKQTDKQKLAQREEALQKIRQKNTMRREVTVELSSQGFWKTGIRSDVCQHAMMLPVLTHHIRYH
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) T
SS






S
TT

SS



B


S



BT
 .........430.........440.........450.........460.........470.........480.........490
Sequence QCLMHLDKLIGYTFQDRCLLQLAMTHPSHHLNFGMNPDHARNSLSNCGIRQPINHNERLEFLGDAVVEFL
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) GGGST


S
SSS
TT
S


SS
TT







S
 .........500.........510.........520.........530.........540.........550.........560
Sequence TSVHLYYLFPSLEEGGLATYRTAIVQNQHLAMLAKKLELDRFMLYAHGPDLCRESDLRHAMANCFQALIG
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)
SS

ST
TTTS




SS


 .........570.........580.........590.........600.........610.........620.........630
Sequence AVYLEGSLEEAKQLFGRLLFNDPDLREVWLNYPLHPLQLQEPNTDRQLIETSPVLQKLTEFEEAIGVIFT
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP) S


STTSSS



SSSS

GGGTTT
SSTT


S
 .........640.........650.........660.........670.........680.........690.........700
Sequence HVRLLARAFTLRTVGFNHLTLGHNQRMEFLGDSIMQLVATEYLFIHFPDHHEGHLTLLRSSLVNNRTQAK
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP)

T

SSS


SSS
S
SSSS

S

TTSS
 .........710.........720.........730.........740.........750.........760........
Sequence VAEELGMQEYAITNDKTKRPVALRTKTLADLLQSFIAALYIDKDLEYVHTFMNVCFFPRLKEFILNQD
Predicted secondary structure




















SS confidence



































































Known secondary structure (DSSP)

TTTS


SSS

S



S
TSTTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D