Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6lw5A_

Fold library idPDB HeaderMoleculeTitle
c6lw5A_2.80PDB header: membrane proteinChain: A: PDB Molecule: soluble cytochrome b562,n-formyl peptide receptor 2;


Added to library: Sat Mar 28 10:01:08 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence PADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILV
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP)



SSST

TTTS


SS
TTTTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence GQIDDALKLANEGKVKEAQAAAEQLKTTRNAYIQKYLTNFSTPLNEYEEVSYESAGYTVLRILPLVVLGV
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) TT
S


TTT
GGG
S
 .........150.........160.........170.........180.........190.........200.........210
Sequence TFVLGVLGNGLVIWVAGFRMTRTVTTICYLNLALADFSFTATLPFLIVSMAMGEKWPFGWFLCKLIHIVV
Predicted secondary structure










SS confidence





































































Known secondary structure (DSSP) TS


TTTTSB

S
 .........220.........230.........240.........250.........260.........270.........280
Sequence DINLFGSVFLIGFIALDRCICVLHPVWAQNHRTVSLAMKVIVGPWILALVLTLPVFLFLTTVTIPNGDTY
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP)


TTT
SSS
 .........290.........300.........310.........320.........330.........340.........350
Sequence CTFNFASWGGTPEERLKVAITMLTARGIIRFVIGFLLPMSIVAICYGLIAAKIHKKGMIKSSRPLRVLTA
Predicted secondary structure






SS confidence





































































Known secondary structure (DSSP)
GGG
SS
TTTS
SSS

S
 .........360.........370.........380.........390.........400.........410.........420
Sequence VVASFFICWFPFQLVALLGTVWLKEMLFYGKYKIIDILVNPTSSLAFFNSCLNPMLYVFVGQDFRERLIH
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP) TS


TTTTS
 .......
Sequence SLPTSLE
Predicted secondary structure



SS confidence






Known secondary structure (DSSP) SSS



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D