Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6lvwA_

Fold library idPDB HeaderMoleculeTitle
c6lvwA_2.49PDB header: hydrolaseChain: A: PDB Molecule: beta-galactosidase bga;


Added to library: Sat Oct 31 09:10:52 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MRLGVCYFPEHWPSEEWERDVAAMADAGLEYVRMAEFSWGVLEPERGTFDFEWLDEAIELIGDHGMQAVL
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)


TTTS
TT
SS

SSTT


TTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence CTPTATPPKWLVDERPSIRQEDPDGTVREHGSRRHYCFNSDAYREETARIVERVTERYADSPHVAGWQTD
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)
GGG



GGGS
B
TT

B

SSSS



TT
TTSSSS

S
 .........150.........160.........170.........180.........190.........200.........210
Sequence NEFGCHETVRCYCDDCADAFRTWLADRYGDIDRLNEAWGNAFWSQQYGSFDEIDPPGPTPAEHHPSRLLA
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP) SSTTTTTTS


SSST
TGGG


SSGGG






SS


 .........220.........230.........240.........250.........260.........270.........280
Sequence YARFSSDSVVEYNRLHADLIREADPDWFVTHNFMGRFPTLNAYDVSEDLDRVAWDSYPTGFVQDRYDGEA
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP)
SS


TT

SS
TT
S
TTS

SS

 .........290.........300.........310.........320.........330.........340.........350
Sequence SPDQLRAGDPDQVGMDHDIYRSALDRPFWVMEQQPGDVNWPPHCPQPGEGAMRLWAHHAAAHGADAVLYF
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)


TTTTS



S

SSSS





TTT
S
 .........360.........370.........380.........390.........400.........410.........420
Sequence RWRRCLEGQEQYHAGLRKADGSPDRGYADAAHTSEEFATLDGASHVDAPVAVVFDYDSLWALNAQPHAPD
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP)
SB

SSSTTTT


SB
SSS
B
S







S



SSTT
 .........430.........440.........450.........460.........470.........480.........490
Sequence FDYWALQEAFYGAVRGRGVQVDVVPPSADLSGYAAVVAPALHLVTEDLADRLTDYIAGGGEVLFGPRTGV
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)

TTT


TTS


S
SS


B

S

SS
SS
 .........500.........510.........520.........530.........540.........550.........560
Sequence KDAENKLRPMSQPGPLTDLVGATVDQHESLPRRLETTVRRVPPVSFRTWAEWLDPDAAEPQYAYDVDGPA
Predicted secondary structure













































SS confidence





































































Known secondary structure (DSSP) B
TTS
B
SS
TTGGGTTSSS

TTS




SSS
B

S
STT
 .........570.........580.........590.........600.........610.........620.........630
Sequence DGRPAVVTNTVGDGQVTYCGVWPESDLADALASDLLDRAGVRYAERLPDGVRIGYRGGRTWVTNFTSDRL
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) TT
B

SSS

TT



S


TTTT

SS
 .........640.........650.........660........
Sequence RLPEIDPESLAVDDSADGIVVGPYGVAVIEGDCVDGLR
Predicted secondary structure






















SS confidence





































Known secondary structure (DSSP) TT

S

SS







TT



S







Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D