Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6lu2A_

Fold library idPDB HeaderMoleculeTitle
c6lu2A_1.75PDB header: transport proteinChain: A: PDB Molecule: substrate binding protein;


Added to library: Sat Mar 28 08:54:51 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence TSTVRVGFDTPQSLSPFNALALPDYQTARLSYDTLVRRDAGGVVPGLAASWTGDAAQLTFTIRDGATCSD
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)




S
S
GGG

SS

STTSSTT
TT
B
TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence GTEITPTVVADSLSAFAKNAGPSTVVDTFGGLNPAITADDAAGTVXITPEAPWADLLAALSVASTGIVCP
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) S
B

S
SSS

TTTT
SS

TTTTSGGG



 .........150.........160.........170.........180.........190.........200.........210
Sequence AGLANLDGLNTGSVEGAESGPYVLSEVEPGVRYTYELRDDYDSWPEWETTLEGEIPKTIEYTVVKDPSAS
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP) T
TTS

TT


SSTTT
TT






SS


SB

S
SS
 .........220.........230.........240.........250.........260.........270.........280
Sequence ANQILSGQLDLGRIXPDSRSRFSDSQLVSNPFGNFYLVFNEREGAVFADEKNREAVAQVLDRDAFDQTTT
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) TS
S
GGGGGGS
GGG

STTSGGGS

 .........290.........300.........310.........320.........330.........340.........350
Sequence DGTGELTDTFGSKATQCATAAPRPALTALDESAAAETLAGVKIRLLGAQVVGAAGAGNTYLEAALREAGA
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) TT
S
SSSS
TTSTTTTSS








TT
TTSSGGGTT
 .........360.........370.........380.........390.........400.........410.........420
Sequence DVTLENVDIGTWAGRVFGQPESYDLTVFPDLNFTGTLTSGISRFTGPDLLQNGGNISGAVSETANALAQQ
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)

GGG
S

TT
SSTTSSSBGGGTSSBSS



 .........430.........440.........450.........460.........470.........480.
Sequence ARTATTPEQKCAADAEAVAALVAEHHTVPLLVESFIYAKRDGFSVTXLGGSLDDHLFRITK
Predicted secondary structure




















SS confidence




























































Known secondary structure (DSSP) T
SSTTS


TT

TT
SS




Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D