Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6ltuA_

Fold library idPDB HeaderMoleculeTitle
c6ltuA_2.57PDB header: hydrolase/rna/dnaChain: A: PDB Molecule: cas12i2;


Added to library: Sat Oct 31 08:34:45 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SMSSAIKSYKSVLRPNERKNQLLKSTIQCLEDGSAFFFKMLQGLFGGITPEIVRFSTEQEKQQQDIALWC
Predicted secondary structure













SS confidence





































































Known secondary structure (DSSP)
B


T

TTT
SS


 .........80.........90.........100.........110.........120.........130.........140
Sequence AVNWFRPVSQDSLTHTIASDNLVEKFEEYYGGTASDAIKQYFSASIGESYYWNDCRQQYYDLCRELGVEV
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP)
TTT

SB

TS


SB

TT
T

 .........150.........160.........170.........180.........190.........200.........210
Sequence SDLTHDLEILCREKCLAVATESNQNNSIISVLFGTGEKEDRSVKLRITKKILEAISNLKEIPKNVAPIQE
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) TTSS
BTTB


TT

S



S
SS

SBS
 .........220.........230.........240.........250.........260.........270.........280
Sequence IILNVAKATKETFRQVYAGNLGAPSTLEKFIAKDGQKEFDLKKLQTDLKKVIRGKSKERDWCCQEELRSY
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) T

TTTTT
SS

S
SSSB

SS



SS
 .........290.........300.........310.........320.........330.........340.........350
Sequence VEQNTIQYDLWAWGEMFNKAHTALKIKSTRNYNFAKQRLEQFKEIQSLNNLLVVKKLNDFFDSEFFSGEE
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP) S
S

S

GGGGSTT


SS
 .........360.........370.........380.........390.........400.........410.........420
Sequence TYTICVHHLGGKDLSKLYKAWEDDPADPENAIVVLCDDLKNNFKKEPIRNILRYIFTIRQECSAQDILAA
Predicted secondary structure















SS confidence





































































Known secondary structure (DSSP)




GGGGTGGGSTT


SSB



TTTS
 .........430.........440.........450.........460.........470.........480.........490
Sequence AKYNQQLDRYKSQKANPSVLGNQGFTWTNAVILPEKAQRNDRPNSLDLRIWLYLKLRHPDGRWKKHHIPF
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)
B


B





TT
B

GGG




BTTB



TTS
 .........500.........510.........520.........530.........540.........550.........560
Sequence YDTRFFQEIYAAGNSPVDTCQFRTPRFGYHLPKLTDQTAIRVNKKHVKAAKTEARIRLAIQQGTLPVSNL
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)
TTS



SS
SSSSGGGT






TT





GGGT



S
 .........570.........580.........590.........600.........610.........620.........630
Sequence KITEISATINSKGQVRIPVKFDVGRQKGTLQIGDRFCGYDQNQTASHAYSLWEVVKEGQYHKELGCFVRF
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP)






TT



S

TT


SSS

SSSTTTT
 .........640.........650.........660.........670.........680.........690.........700
Sequence ISSGDIVSITENRGNQFDQLSYEGLAYPQYADWRKKASKFVSLWQITKKNKKKEIVTVEAKEKFDAICKY
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)


TTTTT




GGGGTT


SSS

T
 .........710.........720.........730.........740.........750.........760.........770
Sequence QPRLYKFNKEYAYLLRDIVRGKSLVELQQIRQEIFRFIEQDCGVTRLGSLSLSTLETVKAVKGIIYSYFS
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP)


TT

STTSTTT


SS
 .........780.........790.........800.........810.........820.........830.........840
Sequence TALNASKNNPISDEQRKEFDPELFALLEKLELIRTRKKKQKVERIANSLIQTCLENNIKFIRGEGDLSTT
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) TT

SSS



TT

S




 .........850.........860.........870.........880.........890.........900.........910
Sequence NNATKKKANSRSMDWLARGVFNKIRQLAPMHNITLFGCGSLYTSHQDPLVHRNPDKAMKCRWAAIPVKDI
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP)
TTB

GGGGT


TTTTTB
TTTTTSSS

B


GGG
 .........920.........930.........940.........950.........960.........970.........980
Sequence GDWVLRKLSQNLRAKNIGTGEYYHQGVKEFLSHYELQDLEEELLKWRSDRKSNIPCWVLQNRLAEKLGNK
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP)
TT

TTTTT
T

TT
TTS

SSS
 .........990.........1000.........1010.........1020.........1030....
Sequence EAVVYIPVRGGRIYFATHKVATGAVSIVFDQKQVWVCNADHVAAANIALTVKGI
Predicted secondary structure














SS confidence





















































Known secondary structure (DSSP) SS
TT
SSS

STT

SS






Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D