Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6lt0D_

Fold library idPDB HeaderMoleculeTitle
c6lt0D_3.20PDB header: protein bindingChain: D: PDB Molecule: wd repeat-containing protein 41;


Added to library: Sat Apr 18 08:53:51 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence NPYTELLVLKAHHDIVRFLVQLDDYRFASAGDDGIVVVWNAQTGEKLLELNGHTQKITAIITFPLILTAS
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)





SS
TTTTS
SSS





S



 .........80.........90.........100.........110.........120.........130.........140
Sequence ADRTVIVWDGDTTRQVQRISCFQSTVKCLTVLQRLDVWLSGGNDLCVWNRKLDLLCKTSHLSDTGISALV
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP) SSS

TTT
S




SS





TTTT


SSS


SSS







SS



 .........150.........160.........170.........180.........190.........200.........210
Sequence EIPKCVVAAVGKELIIFRLVAPILEVKRLLDHQDNILSLINVNDLSFVTGSHVGELIIWDADTQQEIKLC
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP)


SSSS















SS

SSSSSS






 .........220.........230.........240.........250.........260.........270.........280
Sequence QKISIHHFTCDEENVFAAVGRGLYVYSLQMKRVIACQKTAHDSNVLHVARLPNRQLISCSEDGSVRIWEL
Predicted secondary structure































































SS confidence





































































Known secondary structure (DSSP)








TT


TT


SSS
SS

S
SSSS



TTT

SSS


 .........290.........300.........310.........320.........330.........340...
Sequence RELIGDLIGHSSSVEMFLYFEDHGLVTCSADHLIILWKNGERESGLRSLRLFQKLEENGDLYL
Predicted secondary structure































SS confidence






























































Known secondary structure (DSSP)





SS

SSS
TTS
TTTSSTTSSS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D