Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6lt0B_

Fold library idPDB HeaderMoleculeTitle
c6lt0B_3.20PDB header: protein bindingChain: B: PDB Molecule: guanine nucleotide exchange protein smcr8;


Added to library: Sat Apr 18 08:24:20 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence FILISEFSDTKVFGTFDLNYFSLRIMSVDYQASFVGHPPGSYPKLNFVEDSKEGAFAYVHHLTGFVRPFC
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)








B
SSSS
STT

S
TTSSS
SS

















 .........80.........90.........100.........110.........120.........130.........140
Sequence MAYISADQHKIMQQFQELSAEFSRASECLKTGNRKAFATEYFTQTLAQLSHIEHMFRGDLCYLLTSQIDR
Predicted secondary structure






SS confidence





































































Known secondary structure (DSSP) S
TTTTTTTTTSTT

TTT
S
S
 .........150.........160.........170.........180.........190.........200.........210
Sequence ALLKQQHITNFLFEDRHKKRAGQNALKFIRQYPFAHPAIYSLLSGRTLVVLGEDEAIVRKLVTALAIFVP
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP)

SGGGGT


TTSSS
T
B
SSGGG

 .........220.........230.........240.........250.........260.........270.........280
Sequence SYGCYAKPVKHWASSPLHIMDFQKWKLIGLQRVAGTLHALSRYSRYTSILDLDNKTLRCPLYRGTLVPRL
Predicted secondary structure










































SS confidence





































































Known secondary structure (DSSP)
SSSSS

B

S

S


TT
S




GGGTTSB

TTTTB




S
 .........290.........300.........310.........320.........330.........340.........350
Sequence ADHRTQIKRGSTYYLHVQSMLTQLCSKAFLYTFCHHLHLPTHDKETEELVASRQMSFLKLTLGLVNEDVR
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) S
SS



ST
S

SSS

TS


TT
 .........360.........370.........380......
Sequence VVQYLAELLKLHYMQESPGTSHPMLRFDYVPSFLYK
Predicted secondary structure














SS confidence



































Known secondary structure (DSSP) S
SSSS












Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D