Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6lr0U_

Fold library idPDB HeaderMoleculeTitle
c6lr0U_3.50PDB header: membrane proteinChain: U: PDB Molecule: bile salt export pump;


Added to library: Sat Apr 18 17:32:10 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence DDKGTMSDSVILRSIKKFGEENDGFESDKSYNNDKKRVGFFQLFRFSSSTDIWLMFVGSLCAFLHGIAQP
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)

TTTTTTTSTSSS



SSS









GGGTT
S

TTTSSST
 .........80.........90.........100.........110.........120.........130.........140
Sequence GVLLIFGTMTDVFIDYDVELQELQIPGKACVNNTIVWTNSSLNQNMTNGTRCGLLNIESEMIKFASYYAG
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP) TSTTT

SSSSSS
SSSSS
SSSSS

SSTTTT



STTTTTTTTTTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence IAVAVLITGYIQICFWVIAAARQIQKMRKFYFRRIMRMEIGWFDCNSVGELNTRFSDDINKINDAIADQM
Predicted secondary structure






SS confidence





































































Known secondary structure (DSSP) TTTTTTTTSS
SSGGGSS
TTSSST
 .........220.........230.........240.........250.........260.........270.........280
Sequence ALFIQRMTSTICGFLLGFFRGWKLTLVIISVSPLIGIGAATIGLSVSKFTDYELKAYAKAGVVADEVISS
Predicted secondary structure
SS confidence





































































Known secondary structure (DSSP) TTSTTTTTTTTTSTT
TTTTSSTTTTTSTTTSSGGGTTTSTTTGGGTTTTSSSSSSS
 .........290.........300.........310.........320.........330.........340.........350
Sequence MRTVAAFGGEKREVERYEKNLVFAQRWGIRKGIVMGFFTGFVWCLIFLCYALAFWFGSTLVLDEGEYTPG
Predicted secondary structure









SS confidence





































































Known secondary structure (DSSP) GGGTTTTTTTGGGTSSSTTTTTT




TTTTS

S
 .........360.........370.........380.........390.........400.........410.........420
Sequence TLVQIFLSVIVGALNLGNASPCLEAFATGRAAATSIFETIDRKPIIDCMSEDGYKLDRIKGEIEFHNVTF
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) TTTTTSTSSSTTTTS


SS



SSS









 .........430.........440.........450.........460.........470.........480.........490
Sequence HYPSRPEVKILNDLNMVIKPGEMTALVGPSGAGKSTALQLIQRFYDPCEGMVTVDGHDIRSLNIQWLRDQ
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP)

SSS
S

S

TTS

SS
SSSSTTTTSS

SSS
SSSSBSTTS
TTT
 .........500.........510.........520.........530.........540.........550.........560
Sequence IGIVEQEPVLFSTTIAENIRYGREDATMEDIVQAAKEANAYNFIMDLPQQFDTLVGEGGGQMSGGQKQRV
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)
SS



SSTTTTTTTTSSTT

STTTTT
TTTTTSSSSSS

TTTTTS



TT
 .........570.........580.........590.........600.........610.........620.........630
Sequence AIARALIRNPKILLLDMATSALDNESEAMVQEVLSKIQHGHTIISVAHRLSTVRAADTIIGFEHGTAVER
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP) T

S
STTSSS
SSSTTTS

SS

SSTSSS
B


SSS




 .........640.........650.........660.........670.........680.........690.........700
Sequence GTHEELLERKGVYFTLVTLQSQVEPAPVRRILKFSAPEWPYMLVGSVGAAVNGTVTPLYAFLFSQILGTF
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)

SS
TTTTSSTTTS






T
TTTTTTTTTTTTTSSTTTT
 .........710.........720.........730.........740.........750.........760.........770
Sequence SIPDKEEQRSQINGVCLLFVAMGCVSLFTQFLQGYAFAKSGELLTKRLRKFGFRAMLGQDIAWFDDLRNS
Predicted secondary structure













SS confidence





































































Known secondary structure (DSSP) S
S
TTSTTTTTTTTTTTTTTTTS
SSSTTSSSS
 .........780.........790.........800.........810.........820.........830.........840
Sequence PGALTTRLATDASQVQGAAGSQIGMIVNSFTNVTVAMIIAFSFSWKLSLVILCFFPFLALSGATQTRMLT
Predicted secondary structure
SS confidence





































































Known secondary structure (DSSP) TTTSSSTTTTGGGTTTTTTTTTTTTTTTT
TTTTTTGGGGSTTSSSTTTSST
 .........850.........860.........870.........880.........890.........900.........910
Sequence GFASRDKQALEMVGQITNEALSNIRTVAGIGKERRFIEALETELEKPFKTAIQKANIYGFCFAFAQCIMF
Predicted secondary structure



SS confidence





































































Known secondary structure (DSSP) TTTTTTTTTSSS
SSSTTTTTTTTTTTTSSS
 .........920.........930.........940.........950.........960.........970.........980
Sequence IANSASYRYGGYLISNEGLHFSYVFRVISAVVLSATALGRAFSYTPSYAKAKISAARFFQLLDRQPPISV
Predicted secondary structure










SS confidence





































































Known secondary structure (DSSP) TTTT


TTTTSSTTTSSSTTSS

TTTTTTTTTTTS


SS
S
 .........990.........1000.........1010.........1020.........1030.........1040.........1050
Sequence YNTAGEKWDNFQGKIDFVDCKFTYPSRPDSQVLNGLSVSISPGQTLAFVGSSGCGKSTSIQLLERFYDPD
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) S

S
S




TT


BSS
B


SSS
S
S









SS





S
TTTTSSTTSSSS

S
 .........1060.........1070.........1080.........1090.........1100.........1110.........1120
Sequence QGKVMIDGHDSKKVNVQFLRSNIGIVSQEPVLFACSIMDNIKYGDNTKEIPMERVIAAAKQAQLHDFVMS
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) B

B
SSS

SSSS
STT
SS



SS
TTTT
TTTT

STTTSTTSTTTT
TTTTTS
 .........1130.........1140.........1150.........1160.........1170.........1180.........1190
Sequence LPEKYETNVGSQGSQLSRGEKQRIAIARAIVRDPKILLLDEATSALDTESEKTVQVALDKAREGRTCIVI
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) SSSSS



SSSS



TTTTTTS

S
S



SSTTS
SSSB



 .........1200.........1210.........1220.........1230..
Sequence AHRLSTIQNADIIAVMAQGVVIEKGTHEELMAQKGAYYKLVT
Predicted secondary structure














SS confidence









































Known secondary structure (DSSP)
SSTTS


SS




SS






SSSSTTTS

T


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D