Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6lpiA_

Fold library idPDB HeaderMoleculeTitle
c6lpiA_2.85PDB header: recombinationChain: A: PDB Molecule: acetolactate synthase isozyme 1 large subunit;


Added to library: Sat Nov 21 09:06:45 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence KRFTGAEFIVHFLEQQGIKIVTGIPGGSILPVYDALSQSTQIRHILARHEQGAGFIAQGMARTDGKPAVC
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP)
TT




GGGT
SS

SSSS
 .........80.........90.........100.........110.........120.........130.........140
Sequence MACSGPGATNLVTAIADARLDSIPLICITGQVPASEVDTYGISIPITKHNYLVRHIEELPQVMSDAFRIA
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP)
TTT








GGGSS

SGGG
 .........150.........160.........170.........180.........190.........200.........210
Sequence QSGRPGPVWIDIPKDVQTAVFEIQPAMAEKAAAPAFSEESIRDAAAMINAAKRPVLYLGGGVINAPARVR
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) SSS


S
















SS
GGGTT
 .........220.........230.........240.........250.........260.........270.........280
Sequence ELAEKAQLPTTMTLMALGMLPKAHPLSLGMLGMHGVRSTNYILQEADLLIVLGARFDDRAIGKTEQFCPN
Predicted secondary structure















































SS confidence





































































Known secondary structure (DSSP) TT


GGGTTSS
TT
TT
STTS
TT
SS




SGGGSSTT
 .........290.........300.........310.........320.........330.........340.........350
Sequence AKIIHVDIDRAELGKIKQPHVAIQADVDDVLAQLIPLVEAQPRAEWHQLVADLQREFPCPPLSHYGLINA
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)
S
GGGTTTSS

SS
GGGS




TS





S
 .........360.........370.........380.........390.........400.........410.........420
Sequence VAACVDDNAIITTDVGQHQMWTAQAYPLNRPRQWLTSGGLGTMGFGLPAAIGAALANPDRKVLCFSGDGS
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) TTS
TT

SSS


STT



SS

TT

SSS
 .........430.........440.........450.........460.........470.........480.........490
Sequence LMMNIQEMATASENQLDVKIILMNNEALGLVHQQQSLFYEQGVFAATYPGKINFMQIAAGFGLETCDLND
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) TTTTTTT


SB


TT


S
B

S


TT



 .........500.........510.........520.........530.
Sequence PQASLQEIINRPGPALIHVRIDAEEKVYPMVPPGAANTEMV
Predicted secondary structure
























SS confidence








































Known secondary structure (DSSP)
SSS


TT


SS


TT

TT



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D