Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6lpfB_

Fold library idPDB HeaderMoleculeTitle
c6lpfB_2.49PDB header: rna binding proteinChain: B: PDB Molecule: leucine--trna ligase, cytoplasmic;


Added to library: Sat Mar 28 09:08:22 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence TAKVDFLKKIEKEIQQKWDTERVFEVNASNLEKQTSKGKYFVTFPYPYMNGRLHLGHTFSLSKCEFAVGY
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)
TTT



SS




B
SS

B
 .........80.........90.........100.........110.........120.........130.........140
Sequence QRLKGKCCLFPFGLHCTGMPIKACADKLKREIELYGCPPDFPKYQWGIMKSLGLSDEEIVKFSEAEHWLD
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) TT




BB

BSBTTB




TT

TTS
 .........150.........160.........170.........180.........190.........200.........210
Sequence YFPPLAIQDLKRMGLKVDWRRSFITTDVNPYYDSFVRWQFLTLRERNKIKFGKRYTIYSPKDGQPCMDHD
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) T



GGG

B
STTSTT
TTTT

GGG
 .........220.........230.........240.........250.........260.........270.........280
Sequence RQTGEGVGPQEYTLLKLKVLEPYPSKLSGLKGKNIFLVAATLRPETMFGQTNCWVRPDMKYIGFETVNGD
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) BSS
SS


SS

GGGGGGTTS
S
GGGGGG


TTS
TTS
 .........290.........300.........310.........320.........330.........340.........350
Sequence IFICTQKAARNMSYQGFTKDNGVVPVVKELMGEEILGASLSAPLTSYKVIYVLPMLTIKEDKGTGVVTSV
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)
TTTT
SSSTT


GGGGTT

SS
S
S

TT

TTSTTS
 .........360.........370.........380.........390.........400.........410.........420
Sequence PSDSPDDIAALRDLKKKQALRAKYGIRDDMVLPFEPVPVIEIPGFGNLSAVTICDELKIQSQNDREKLAE
Predicted secondary structure


















































SS confidence





































































Known secondary structure (DSSP) TTT

TT

GGGTTT





BTTTBTTT

STT
 .........430.........440.........450.........460.........470.........480.........490
Sequence AKEKIYLKGFYEGIMLVDGFKGQKVQDVKKTIQKKMIDAGDALIYMEPEKQVMSRSSDECVVALCDQWYL
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)

STTTTT
BTTSSS

BBTT

B
 .........500.........510.........520.........530.........540.........550.........560
Sequence DYGEENWKKQTSQCLKNLETFCEETRRNFEATLGWLQEHACSRTYGLGTHLPWDEQWLIESLSDSTIYMA
Predicted secondary structure


















































SS confidence





































































Known secondary structure (DSSP) TT
SB
SS


SSSBS
B
TT
TTS
TTTS
SST
 .........570.........580.........590.........600.........610.........620.........630
Sequence FYTVAHLLQGGNLHGQAESPLGIRPQQMTKEVWDYVFFKEAPFPKTQIAKEKLDQLKQEFEFWYPVDLRV
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP) TTTTT
TTS
S

TT


GGG


TT



SSSS

S

 .........640.........650.........660.........670.........680.........690.........700
Sequence SGKDLVPNHLSYYLYNHVAMWPEQSDKWPTAVRANGHLLLNSEKMSKSTGNFLTLTQAIDKFSADGMRLA
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) GGGTTTSTT
GGGS

B

TT
BTTTTB

B
 .........710.........720.........730.........740.........750.........760.........770
Sequence LADAGDTVEDANFVEAMADAGILRLYTWVEWVKEMVANWDSLRSGPASTFNDRVFASELNAGIIKTDQNY
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP) TS
SSSS

TSTTSB
S


S
 .........780.........790.........800.........810.........820.........830.........840
Sequence EKMMFKEALKTGFFEFQAAKDKYRELAVEGMHRELVFRFIEVQTLLLAPFCPHLCEHIWTLLGKPDSIMN
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP) TT
T
TT

BTTT
TT
SS
GGG
 .........850.........860.........870.........880.........890.........900.........910
Sequence ASWPVAGPVNEVLIHSSQYLMEVTHDLRLRLKNYMMPSHCTIYVAKNYPPWQHTTLSVLRKHFEANNGKL
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP)









SS





SS

TTS

 .........920.........930.........940.........950.........960.........970.........980
Sequence PDNKVIASELGSMPELKKYMKKVMPFVAMIKENLEKMGPRILDLQLEFDEKAVLMENIVYLTNSLELEHI
Predicted secondary structure











SS confidence





































































Known secondary structure (DSSP)

SGGGGGGTTTGGGGG
SS
SS
TT
S
 .........990.........1000......
Sequence EVKFASEAEDKIREDCCPGKPLNVFR
Predicted secondary structure











SS confidence

























Known secondary structure (DSSP)
STTS

BTTB


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D