Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6lirD_

Fold library idPDB HeaderMoleculeTitle
c6lirD_2.09PDB header: immune systemChain: D: PDB Molecule: tcr beta chain;


Added to library: Sat Nov 21 09:02:39 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence EINQPSILVLKEDENATLSCRQNDNHDYMSWYLQQPGKGLQLIYSSYGVKQENKGDIHTGYEAKRSSQEV
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)


STT

SS

S
TTS

TT
TT
TT

SSS
 .........80.........90.........100.........110.........120.........130.........140
Sequence FHLDIISAKKNHSAIYFCASSSYKGNTPLNFGQGTRLTVLGKNSEIIEPDVVIFSPSKQEIQEKKKATLV
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)
S

GGG
SSSSS






TT


B




S
 .........150.........160.........170.........180.........190.........200.........210
Sequence CLASGFFPDHLNLVWKVNGVKRTEGVGTDEISTSNGSTYSLTSRLRISAQEWFNPLNRFECIANFFKNGT
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) BSS

TT
TT
SS
TTS
TT
TT
 .........220..
Sequence QQSIQKIIYGDT
Predicted secondary structure


SS confidence











Known secondary structure (DSSP)



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D