Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6lhuB_

Fold library idPDB HeaderMoleculeTitle
c6lhuB_3.46PDB header: dna repairChain: B: PDB Molecule: fanconi anemia complementation group a;


Added to library: Sat Mar 28 08:28:52 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SQAHQDVEKALNIFENTGKIPASVMEASIFRRPYFTSRFLPALLTPRVLPAAPDALMLLIDSMKRADKIP
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)

S
S

SS
SSSSSSSTT




SSS
SSTTTSS
 .........80.........90.........100.........110.........120.........130.........140
Sequence TNMFNAYIEACEQEKLRKQKPLGILQSALSDLRPLVTDANKYEDVSAQVAVISEKLIADIQEQTVADLLL
Predicted secondary structure













SS confidence





































































Known secondary structure (DSSP)
TTS



TTTT

SS
TTT


 .........150.........160.........170.........180.........190.........200.........210
Sequence TCFCQCLIAASGTNPPDRQGQWPTLYVKMLCGHQWAFAAVLRRMLQLLRFQAPFLKDSHIVGLAAFSIHL
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) TTTS
TTT

SS
SSSTSGGGS
SSSSTT
 .........220.........230.........240.........250.........260.........270.........280
Sequence HECQPSLQFLITGVQNLEHYWENLLNLLCSDSVGVCLKLCTAAISYAFCRFSELHQDIFSGCVPPLFLRK
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP) TTT





SSS

S
T
STTTTTT
SS
TTTGGGTS
 .........290.........300.........310.........320.........330.........340.........350
Sequence LQYLVPRLIWETRGEVIRDDEEADSPLNWNLYALAGWKEAALSLWNQNRLQGLLREKSFQVTFMDWLLWE
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP) S
S
SSSS



SS
SS




TTS
S
TTSTTTTTTT
TTTTSSTT


TT
 .........360.........370.........380.........390.........400.........410.........420
Sequence MTLKSNNDVLCDTDRQEYQRWAVNHYLSESSVVGGCNGDLERGCITIAEAVLQFSNKSHTGLGDILCRLQ
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) TT

TTSSSS
TTSSSS
SSSSS
SS




S
 .........430.........440.........450.........460.........470.........480.........490
Sequence ELICDIVTSHHQKGRRHFFFAIFYQRLELHKGKKELSNHLSKQGVLEMCCRILLGLPPLFLINTPSEKGI
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) TT

SSS
TTTGGGS

SSSSTTS
SS
SS




SSS
 .........500.........510.........520.........530.........540.........550.........560
Sequence RTLGSEDFWQFVNKELKNLGPRGYALPYNITAHFFRGVISASVQCKDSSEAVNSILSATYSTCPALLISA
Predicted secondary structure
















SS confidence





































































Known secondary structure (DSSP)





SSSTTTSSTTSS


TTTTTTTTTTSSSSSSTTTS
T
 .........570.........580.........590.........600.........610.........620.........630
Sequence AVGWPQLDPVLRSQWCSLFGVDLPKELRTLREQQASVDSCLSQGEKLSLSCTPWLSAAFLYSTVQRKKLP
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) TT
TTTT
S


SSSS


B


S
TTTTTTT

 .........640.........650.........660.........670.........680.........690.........700
Sequence CSRMLEILDGLSSNFSMVLISLLFFSVMDIIYMFLKDGRKHKDLLENCVHIIHCLEQKGETWVWLFQMTD
Predicted secondary structure










SS confidence





































































Known secondary structure (DSSP) STTB

SSSS
SSTTTTTTTT
S

TTTT




GGG

S
 .........710.........720.........730.........740.........750.........760.........770
Sequence ERKPELGLHLHRAASDVFLNLMPFAFFWLVPSLQLEQVVQQQDFLVIALDMYHKFLQLFVHLDSHDVFTC
Predicted secondary structure










SS confidence





































































Known secondary structure (DSSP) SS

TTTS
TTGGG

SSSSTT
SS
TTSS


TTTS
 .........780.........790.........800.......
Sequence GRQFLLCCVPKCQKPNSAILKKMLESWEEHDPELAAV
Predicted secondary structure








SS confidence




































Known secondary structure (DSSP) TTTS

SS
SSSTTTT
SSTTTTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D