Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6lhuA_

Fold library idPDB HeaderMoleculeTitle
c6lhuA_3.46PDB header: dna repairChain: A: PDB Molecule: fanconi anemia complementation group a;


Added to library: Sat Mar 28 08:33:58 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence EPLGILQSALSDLRPLVTDANKYEDVSAQVAVISEKLIAQEQTVADLLLTCFCQCLIAASGTNPPDRQGQ
Predicted secondary structure
















SS confidence





































































Known secondary structure (DSSP)
TTTTGGGTTT
TTTTTTT



SBTTB
STTS
S
 .........80.........90.........100.........110.........120.........130.........140
Sequence WPTLYVKMLCGHQWAFAAVLRRMLQLLRFQAPFLKDSHIVGLAAFSIHLHECQPSLQFLITGVQNLEHYW
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) TSTTTTTTTTSSS

TT
TT


S

TT
SSS
 .........150.........160.........170.........180.........190.........200.........210
Sequence ENLLNLLCSDSVGVCLKLCTAAISYAFCRFSELHQDIFSGCVPPLFLRKLQYLVPRLIWETRGEVADSPL
Predicted secondary structure
















SS confidence





































































Known secondary structure (DSSP)
STTTSSSTTSTTS
TTTTTTSS
TT
STTSS




SS
 .........220.........230.........240.........250.........260.........270.........280
Sequence NWNLYALAGWKEAALSLWNQNRLQGLLREKSFQVTFMDWLLWEMTLKSNNDVLCDTDRQEYQRWAVNHYL
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) SSGGGG
S
STTTTTTTTS
TTTTTTTTSGGG


STT
BSTT
SS
TTTTTTT
 .........290.........300.........310.........320.........330.........340.........350
Sequence SESSVVGGCNGDLERGCITIAEAVLQFSNRHIQHSLKSHTGLGDILCRLQELICDIVTSHHQKGRRHFFF
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) BS
TTTTS
BS
SSTT








BSTTTTTTTGGGTSSSSS




STTT
 .........360.........370.........380.........390.........400.........410.........420
Sequence AIFYQRLELHKHLSKQGVLEMCCRILLGLPPLFLINTPSEKGIRTLGSEDFWQFVNKELKNLGPRGYALP
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP) TTT


TTTS
TTTTS



TTS





SSSTTTTTS
TTTSS


 .........430.........440.........450.........460.........470.........480.........490
Sequence YNITAHFFRGVISASVQCKDSSEAVNSILSATYSTCPALLISAAVGWPQLDPVLRSQWCSLFGVDLPKEL
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) STTTTTTTTSSSTTTSTTSS
TTGGGT





TTS
 .........500.........510.........520.........530.........540.........550.........560
Sequence RTLREQQASVDSCLSQGEKLSLSCTPWLSAAFLYSTVQRKKLPCSRMLEILDGLSSNFSMVLISLLFFSV
Predicted secondary structure















SS confidence





































































Known secondary structure (DSSP) STTTTT






S
T

SSSTTTSS
SS
TTS
 .........570.........580.........590.........600.........610.........620.........630
Sequence MDIIYMFLKDGRKHKDLLENCVHIIHCLEQKGETWVWLFQMTDERKPELGLHLHRAASDVFLNLMPFAFF
Predicted secondary structure













SS confidence





































































Known secondary structure (DSSP) TSS



TT



TTTT

S
SS

TTS
TTTT
 .........640.........650.........660.........670.........680.........690.........700
Sequence WLVPSLQLEQVVQQQDFLVIALDMYHKFLQLFVHHLDSHDVFTCGRQFLLCCVPKCQKPNSAILKKMLES
Predicted secondary structure













SS confidence





































































Known secondary structure (DSSP) TSSTTS
SSTTSSSSS


TTTTTTSSSTT
SSSSS
 .........710.
Sequence WEEHDPELAAV
Predicted secondary structure



SS confidence










Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D