Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6lhsA_

Fold library idPDB HeaderMoleculeTitle
c6lhsA_3.35PDB header: dna repairChain: A: PDB Molecule: fanconi anemia complementation group a;


Added to library: Sat Mar 28 08:28:13 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence EPLGILQSALSDLRPLVTDANKYEDVSAQVAVISEKLIAQLDIQEQTVADLLLTCFCQCLIAASGTNPPD
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP)
TTTTGGGTTT
TTTTTTT




SS
SBTTB
ST
 .........80.........90.........100.........110.........120.........130.........140
Sequence RQGQWPTLYVKMLCGHQWAFAAVLRRMLQLLRFQAPFLKDSHIVGLAAFSIHLHECQPSLQFLITGVQNL
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) TS
STSTTTTTTTTSSS

SSTTT


S
STT
SSS
 .........150.........160.........170.........180.........190.........200.........210
Sequence EHYWENLLNLLCSDSVGVCLKLCTAAISYAFCRFSELHQDIFSGCVPPLFLRKLQYLVPRLIWETRGEVI
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP)
STTTSSSTTSTTS
TTTTTTSS
TT
GGGSS


 .........220.........230.........240.........250.........260.........270.........280
Sequence RDDEEADSPLNWNLYALAGWKEAALSLWNQNRLQGLLREKSFQVTFMDWLLWEMTLKSNNDVLCDTDRQE
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)







SSSSGGGG
S
STTTTTTTTS
TTTTTTTTSGGG


STT
BSTT
SS
TTTTT
 .........290.........300.........310.........320.........330.........340.........350
Sequence YQRWAVNHYLSESSVVGGCNGDLERGCITIAEAVLQFSNRHIQHSEWESRNISMLKSHTGLGDILCRLQE
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) TTBS
GGGTS
BS
SGGGTSGGG





SS








BSTTTT
 .........360.........370.........380.........390.........400.........410.........420
Sequence LICDIVTSHHQKGRRHFFFAIFYQRLELHKGKKELSNHLSKQGVLEMCCRILLGLPPLFLINTPSEKGIR
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP) TTTSSSSS




STTTTTTSS
SSSTTS
TTTS
TTTTS



TTS

 .........430.........440.........450.........460.........470.........480.........490
Sequence TLGSEDFWQFVNKELKNLGPRGYALPYNITAHFFRGVISASVQCKDSSEAVNSILSATYSTCPALLISAA
Predicted secondary structure















SS confidence





































































Known secondary structure (DSSP)



SSSTTTTTS
TTTSSS

STTTTTTTTTSSSTTTSTTSS
GGGT
 .........500.........510.........520.........530.........540.........550.........560
Sequence VGWPQLDPVLRSQWCSLFGVDLPKELRTLREQQASVDSCLSQGEKLSLSCTPWLSAAFLYSTVQRKKLPC
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) TTGGGT





SSSSTTTSS






S
T

S
 .........570.........580.........590.........600.........610.........620.........630
Sequence SRMLEILDGLSSNFSMVLISLLFFSVMDIIYMFLKDGRKHKDLLENCVHIIHCLEQKGETWVWLFQMTDE
Predicted secondary structure










SS confidence





































































Known secondary structure (DSSP) SSS
SS
TTSTSSS


TT



TTTT

S
S
 .........640.........650.........660.........670.........680.........690.........700
Sequence RKPELGLHLHRAASDVFLNLMPFAFFWLVPSLQLEQVVQQQDFLVIALDMYHKFLQLFVHHLDSHDVFTC
Predicted secondary structure










SS confidence





































































Known secondary structure (DSSP) S

TTS
TTTTTSSTTS
SSTTSSSSS


GGG
 .........710.........720.........730.......
Sequence GRQFLLCCVPKCQKPNSAILKKMLESWEEHDPELAAV
Predicted secondary structure









SS confidence




































Known secondary structure (DSSP) TTTSS
TT
SSSSS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D