Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6lg1B_

Fold library idPDB HeaderMoleculeTitle
c6lg1B_3.05PDB header: transferaseChain: B: PDB Molecule: lpcgta;


Added to library: Sat Nov 21 08:51:17 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence AVPHVALLPSSGMGHLTPFLRLAAALASHGCVITFITPTPVVSAAEARHVEAFISSSPLFRRLEFPLLPF
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)




SSTT
S
S

TT



 .........80.........90.........100.........110.........120.........130.........140
Sequence SDDPFFLQFERISRSARHLGPVLSSVSPPLSALILDVTLTSSILPIAAEISLPAYILFTSSAGMLSLCLS
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP)


T
SS

SSTTTT


S
 .........150.........160.........170.........180.........190.........200.........210
Sequence YPEIAASGTIKIPGVAEDLAPSSLPQPLRDPRNLFTGQFIENGRAMARADGIIINTWEALEPATLAALQG
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) T



BTTTBSS

GGGS
GGGGSSSSSSS

TTTS
 .........220.........230.........240.........250.........260.........270.........280
Sequence SKAVSGFPLVIPVGPLLAAADDLVIPWLDAQPASSVVFVSFGSRTALSAEQLRELAAGLESSGCRFLWVL
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)
TTTS






GGGGTS
TT


S





S
 .........290.........300.........310.........320.........330.........340.........350
Sequence ELLGEGFLQRVEWKGKVVSGWVDQRAVLDHPSVGGFVSHCGWNSVTEAALGGMRVLAWPRHGDQRINAMV
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP)

SSTTTTT
S


T
TT


T



STT
 .........360.........370.........380.........390.........400.........410.........420
Sequence VEKSGLGKWPSLWTWEGDDEIVRREEIAGRVAELMASPAAAAAAAKVKEEAVRAATAGGSSQRQLEDLVS
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) TS

TTS

SS






STTS
 .....
Sequence RFTCS
Predicted secondary structure


SS confidence




Known secondary structure (DSSP) S


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D