Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6lg0E_

Fold library idPDB HeaderMoleculeTitle
c6lg0E_3.00PDB header: transferaseChain: E: PDB Molecule: sbcgta;


Added to library: Sat Nov 21 09:31:57 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence AHIALFPCAGMGHLLPFLRLAAMLDARGCAVTVITVKPTVSAAESDHLSAFFTIHPRITRLEFQLLPYQK
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)


SSTT
S
SSS
SS





 .........80.........90.........100.........110.........120.........130.........140
Sequence SGLRNDDPFFIQMETIATSVHLLRPLLSSLSPPLSAIVSDFTLTSQVTDLVSDLPISTYTLMTSSAAFFC
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP) SS
B


GGGGT
SS

STTTTTTTT


S
 .........150.........160.........170.........180.........190.........200.........210
Sequence LMAYLPKLLQIDVANRDAIEIPDLGPISMSSIPPKMLDPSDFFSAFISSNVSSLHKVKGVLINTFNSFES
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP) T

S

S

TTS

TTTS

TTBGGGGSSS

TTTT
 .........220.........230.........240.........250.........260.........270.........280
Sequence EAIEAVRRNGVDHILPIGPLESYDAKKAHDLPWLDEQPPESVLFVSFGSRTALSKEQIRELGAALEKSGC
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) TT
TT

S










TS
TTT


SS





 .........290.........300.........310.........320.........330.........340.........350
Sequence RFLWVLKGGKVDKEDKEEVEDMLGASFVERTKKKGLIVKGWVKQEQILAHPAIGGFVSHCGWNSVIEAAR
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP)


-


TTT



S
SS
TTT
S


STT


 .........360.........370.........380.........390.........400.........410.........420
Sequence LGVPVLAWPQHGDQSVNAGVVEKAGLGLWVREWGWGQTKLIGREEIAEKMIEVMQDEKLRVSAGEVRAKA
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP) T




SSTTTS
GGG

BTTB



 .........430.........440...
Sequence KETREVDGDSEALLQRLIHSFNN
Predicted secondary structure




SS confidence






















Known secondary structure (DSSP) SSSS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D