Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6lfzB_

Fold library idPDB HeaderMoleculeTitle
c6lfzB_2.87PDB header: transferaseChain: B: PDB Molecule: sbcgtb;


Added to library: Sat Nov 21 08:54:59 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence QRPHVAVFPCAGMGHLLPYLRLAAMLHSRGCAVSVISAHPTISDAESRSLSSFFSLYPQIRSLEIQLLPD
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)




SSTT
S
SS
SSS



 .........80.........90.........100.........110.........120.........130.........140
Sequence PFFIQRESIGNSIHLLRPLLASLSPPLSAIFVDFPVLTEFSPIAADFSLPTYTLIVTSARFFSLMAHLPR
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) TGGG
SS

S
GGGTTTTT


S
 .........150.........160.........170.........180.........190.........200.........210
Sequence LLEQEDDISKKSEVCVPHLDPIQVSSIPPQMLDRRHFFVETITSNVASLSYLKGVLINTFTWLEPEAVEA
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP) SSS
GGGSS

TTS

GGGS

SSSGGGTSSS

TTTS
 .........220.........230.........240.........250.........260.........270.........280
Sequence LKRNGVDHILPIGPLEAIKAEESDMDLPWLEEQAPKSVLFISFGSRGAHTKEQLREFAAALEKSGWRFLW
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP) TT
TT

S








SSSSS
TT


SS

S


 .........290.........300.........310.........320.........330.........340.........350
Sequence VLKSGKVDREDKEETEDILGSSFLERTKNRGVVIKGWADQERILAHSAIGGFVSHCGWNSVVEAAKLGVP
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP)


TT
STT


SSTTT
TTTTS


TSTT


T

 .........360.........370.........380.........390.........400.........410.........420
Sequence VLAWPPHGDQRVNAEVVEKVGLGLWVRGWGWAGERLIGRDEIAEKLIELRNDERLRERVKEVREKAREER
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP)


STTTS
GGG
STTSS



T
 .........430.........
Sequence ESGGISETLIRDLIHSLKI
Predicted secondary structure




SS confidence


















Known secondary structure (DSSP) STTSTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D