Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6lfnB_

Fold library idPDB HeaderMoleculeTitle
c6lfnB_2.40PDB header: transferaseChain: B: PDB Molecule: lpcgtb;


Added to library: Sat Nov 21 08:51:34 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence GMSPPAPADVVSSAKPHVAVIPAAGMGHLNPTLRLAGELASRGCVVTFINPSPPVSLAEATSVAEFVAST
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP)









SS





SSTT
S
S
S
 .........80.........90.........100.........110.........120.........130.........140
Sequence PGVRLLDLPVQPLDPSCFPAHEDPFLRQFEAVRRSAPLLTPLLSDVSPPLAAIVCDIAICSTFLTVAAEI
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) TT




GGGS
SSS
TGGGS
SS

SGGGT
 .........150.........160.........170.........180.........190.........200.........210
Sequence SLPAYVFFSLSAQMLSLNLAFPTVADQVYGAGEGDEIRFPGLPESIPRSWLPPPLLDPAHLFAVHFVENG
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP) T


S
GGGGS
TT


TT
SS
GGGS
STTS
 .........220.........230.........240.........250.........260.........270.........280
Sequence KAMPRAAGILVHSWEALEPEALAALRGGRVLAGLPPVLPIGPLYPWLDAQRDRSVLFVCFGNRSTHSPEQ
Predicted secondary structure













































SS confidence





































































Known secondary structure (DSSP) GGGSSS

TTT
TTSSSTT









GGGS
TT


TT



 .........290.........300.........310.........320.........330.........340.........350
Sequence LREMAAGLERSGCRFVWVLGEGYLERVKERGVVINGWVDQMTILSHRAVGGFFSHSGSSSVAEAAIGGQP
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)




S
SSTT
SSS
S


TSTT


T

 .........360.........370.........380.........390.........400.........410.........420
Sequence LLLWPMGGDQRMSALVAERRGMGVWPRGWGWSADDKLIPGEEIARRIKDFMGDNALRAVAAKMKKETASA
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)


STTTS

TT


SSS




T
 .........430.........440.
Sequence MAPGGSKDQWFDDFIARINRV
Predicted secondary structure



SS confidence




















Known secondary structure (DSSP) STTS



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D